BLASTX nr result
ID: Rehmannia30_contig00013763
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00013763 (1125 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019181932.1| PREDICTED: replication protein A 70 kDa DNA-... 45 7e-06 >ref|XP_019181932.1| PREDICTED: replication protein A 70 kDa DNA-binding subunit D-like [Ipomoea nil] Length = 519 Score = 44.7 bits (104), Expect(2) = 7e-06 Identities = 23/54 (42%), Positives = 29/54 (53%), Gaps = 4/54 (7%) Frame = -1 Query: 894 GSFWVCAHIIGVS--DEWWYISCIR--CIKKLHPTVDQLYCIKCDHLQPTGRIR 745 G FWV A I+ + EW+Y SC C KKL P + LYC +CD G +R Sbjct: 288 GEFWVAARIVFIDCDGEWYYPSCRTKSCYKKLEPKKEFLYCKECDRTWGDGILR 341 Score = 35.0 bits (79), Expect(2) = 7e-06 Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 11/52 (21%) Frame = -2 Query: 626 LSASATLLCWDRECEQMIGKSCIDLRQ-----------EFVEVIFFNLVFQI 504 + +A + WDREC +++G S +DL+Q E ++ NL+F+I Sbjct: 351 IKGNAPFVMWDRECTELLGLSALDLKQKNSQGKDGVPAEIQALVGLNLIFRI 402