BLASTX nr result
ID: Rehmannia30_contig00013074
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00013074 (548 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN14368.1| hypothetical protein CDL12_12993 [Handroanthus im... 57 9e-07 >gb|PIN14368.1| hypothetical protein CDL12_12993 [Handroanthus impetiginosus] Length = 208 Score = 57.4 bits (137), Expect = 9e-07 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -3 Query: 507 QRKDKMRFLIVGARTAWKFSDADEPVYCYKALNSV 403 + KD MR L VGARTAWKFS ADEP +CYKALNSV Sbjct: 63 KEKDSMRCLNVGARTAWKFSVADEPEHCYKALNSV 97