BLASTX nr result
ID: Rehmannia30_contig00011409
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00011409 (436 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN68035.1| hypothetical protein VITISV_003428 [Vitis vinifera] 42 5e-06 >emb|CAN68035.1| hypothetical protein VITISV_003428 [Vitis vinifera] Length = 396 Score = 42.0 bits (97), Expect(2) = 5e-06 Identities = 27/61 (44%), Positives = 36/61 (59%), Gaps = 5/61 (8%) Frame = -2 Query: 309 LKEIFKYLKGTSSYDLLYPKF*NVLI--FRDN---KSGVNFIFQNMVRHNRTKHIEIRYI 145 +K I +YLKGT L YPK N F D + +N I +N V+H++TKHIEIR+ Sbjct: 108 IKRILRYLKGTMDIGLWYPKGDNFQFIGFSDAELCRFXIN-ISKNXVQHSKTKHIEIRHH 166 Query: 144 F 142 F Sbjct: 167 F 167 Score = 35.8 bits (81), Expect(2) = 5e-06 Identities = 16/28 (57%), Positives = 21/28 (75%) Frame = -1 Query: 385 RLDIPYALCLYARLKNYPNESH*SAVKR 302 R DI Y++CL AR ++ P ESH SA+KR Sbjct: 83 RPDIMYSICLCARFQSCPKESHLSAIKR 110