BLASTX nr result
ID: Rehmannia30_contig00011332
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00011332 (403 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN23559.1| hypothetical protein CDL12_03722 [Handroanthus im... 70 5e-13 gb|PIN23553.1| hypothetical protein CDL12_03724 [Handroanthus im... 67 9e-12 gb|PIN06345.1| hypothetical protein CDL12_21094 [Handroanthus im... 68 1e-10 >gb|PIN23559.1| hypothetical protein CDL12_03722 [Handroanthus impetiginosus] Length = 115 Score = 70.5 bits (171), Expect = 5e-13 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = -3 Query: 401 VMWGKMKEENIENSEDYIGETSSYDAKVPLLKHYTVSIRENAAVV 267 VMWGK+KEE ++ SEDYIGE+SS D KVPLLKHYTVSI+ N A V Sbjct: 71 VMWGKVKEEKVDISEDYIGESSSNDGKVPLLKHYTVSIQGNNAAV 115 >gb|PIN23553.1| hypothetical protein CDL12_03724 [Handroanthus impetiginosus] Length = 107 Score = 67.0 bits (162), Expect = 9e-12 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = -3 Query: 401 VMWGKMKEENIENSEDYIGETSSYDAKVPLLKHYTVSIRENAA 273 VMWGK+KE+ ++ +DYIGE+SS D KVPLLKHYTVSI+EN A Sbjct: 63 VMWGKVKEDKVDILDDYIGESSSNDGKVPLLKHYTVSIQENNA 105 >gb|PIN06345.1| hypothetical protein CDL12_21094 [Handroanthus impetiginosus] Length = 371 Score = 67.8 bits (164), Expect = 1e-10 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = -3 Query: 401 VMWGKMKEENIENSEDYIGETSSYDAKVPLLKHYTVSIRENAA 273 VMWGK+KEE + S+DYIGE+SS D KVPLLKHYTVSI+E+ A Sbjct: 327 VMWGKVKEEKVNISDDYIGESSSNDGKVPLLKHYTVSIQESNA 369