BLASTX nr result
ID: Rehmannia30_contig00011193
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00011193 (611 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011087815.1| tubby-like F-box protein 8 [Sesamum indicum]... 78 3e-13 ref|XP_022876379.1| tubby-like F-box protein 8 [Olea europaea va... 78 3e-13 gb|KZV39288.1| tubby-like F-box protein 8 [Dorcoceras hygrometri... 76 1e-12 gb|PIN13522.1| Tub family protein [Handroanthus impetiginosus] 76 1e-12 gb|OMO79956.1| hypothetical protein CCACVL1_13275 [Corchorus cap... 76 1e-12 ref|XP_021285485.1| tubby-like F-box protein 8 [Herrania umbratica] 76 2e-12 gb|OMO92059.1| hypothetical protein COLO4_17907 [Corchorus olito... 76 2e-12 gb|EOX97416.1| Tubby like protein 10 isoform 1 [Theobroma cacao]... 76 2e-12 ref|XP_007041585.2| PREDICTED: tubby-like F-box protein 8 [Theob... 76 2e-12 ref|XP_019419232.1| PREDICTED: tubby-like F-box protein 8 [Lupin... 76 2e-12 ref|XP_019171591.1| PREDICTED: tubby-like F-box protein 14 [Ipom... 74 7e-12 gb|PIN05161.1| Tub family protein [Handroanthus impetiginosus] 74 7e-12 ref|XP_011092391.1| tubby-like F-box protein 8 [Sesamum indicum]... 74 7e-12 gb|PPS16400.1| hypothetical protein GOBAR_AA04221 [Gossypium bar... 74 1e-11 ref|XP_022762924.1| tubby-like F-box protein 8 [Durio zibethinus... 74 1e-11 ref|XP_019249961.1| PREDICTED: tubby-like F-box protein 8 [Nicot... 74 1e-11 ref|XP_017634078.1| PREDICTED: tubby-like F-box protein 8 [Gossy... 74 1e-11 ref|XP_012480545.1| PREDICTED: tubby-like F-box protein 8 [Gossy... 74 1e-11 ref|XP_009800903.1| PREDICTED: tubby-like F-box protein 8 [Nicot... 74 1e-11 ref|XP_016180060.1| tubby-like F-box protein 8 [Arachis ipaensis] 74 1e-11 >ref|XP_011087815.1| tubby-like F-box protein 8 [Sesamum indicum] ref|XP_011087816.1| tubby-like F-box protein 8 [Sesamum indicum] ref|XP_011087817.1| tubby-like F-box protein 8 [Sesamum indicum] ref|XP_011087818.1| tubby-like F-box protein 8 [Sesamum indicum] Length = 425 Score = 77.8 bits (190), Expect = 3e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = -2 Query: 115 MSFRSIARDIRDSFGSLSRRSFDVRLTGHHRGKSHGSF 2 MSFRSIARDIRDSFGSLSRRSFDVRL GHHRGKSHGSF Sbjct: 1 MSFRSIARDIRDSFGSLSRRSFDVRLPGHHRGKSHGSF 38 >ref|XP_022876379.1| tubby-like F-box protein 8 [Olea europaea var. sylvestris] Length = 427 Score = 77.8 bits (190), Expect = 3e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = -2 Query: 115 MSFRSIARDIRDSFGSLSRRSFDVRLTGHHRGKSHGSF 2 MSFRSIARDIRDSFGSLSRRSFDVRL GHHRGKSHGSF Sbjct: 1 MSFRSIARDIRDSFGSLSRRSFDVRLLGHHRGKSHGSF 38 >gb|KZV39288.1| tubby-like F-box protein 8 [Dorcoceras hygrometricum] Length = 425 Score = 76.3 bits (186), Expect = 1e-12 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -2 Query: 115 MSFRSIARDIRDSFGSLSRRSFDVRLTGHHRGKSHGSF 2 MSFRSIARDIRDSFGSLSRRSFDVRL+GHHRGKSH SF Sbjct: 1 MSFRSIARDIRDSFGSLSRRSFDVRLSGHHRGKSHNSF 38 >gb|PIN13522.1| Tub family protein [Handroanthus impetiginosus] Length = 433 Score = 76.3 bits (186), Expect = 1e-12 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -2 Query: 115 MSFRSIARDIRDSFGSLSRRSFDVRLTGHHRGKSHGSF 2 MSFRSIARDIRDSFGSLSRRSFDVRL+ HHRGKSHGSF Sbjct: 1 MSFRSIARDIRDSFGSLSRRSFDVRLSSHHRGKSHGSF 38 >gb|OMO79956.1| hypothetical protein CCACVL1_13275 [Corchorus capsularis] Length = 395 Score = 75.9 bits (185), Expect = 1e-12 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 115 MSFRSIARDIRDSFGSLSRRSFDVRLTGHHRGKSHGS 5 MSFRSI RD+RDSFGSLSRRSFDVRLTGHHRGKSHGS Sbjct: 1 MSFRSIVRDVRDSFGSLSRRSFDVRLTGHHRGKSHGS 37 >ref|XP_021285485.1| tubby-like F-box protein 8 [Herrania umbratica] Length = 425 Score = 75.9 bits (185), Expect = 2e-12 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 115 MSFRSIARDIRDSFGSLSRRSFDVRLTGHHRGKSHGS 5 MSFRSI RD+RDSFGSLSRRSFDVRLTGHHRGKSHGS Sbjct: 1 MSFRSIVRDVRDSFGSLSRRSFDVRLTGHHRGKSHGS 37 >gb|OMO92059.1| hypothetical protein COLO4_17907 [Corchorus olitorius] Length = 425 Score = 75.9 bits (185), Expect = 2e-12 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 115 MSFRSIARDIRDSFGSLSRRSFDVRLTGHHRGKSHGS 5 MSFRSI RD+RDSFGSLSRRSFDVRLTGHHRGKSHGS Sbjct: 1 MSFRSIVRDVRDSFGSLSRRSFDVRLTGHHRGKSHGS 37 >gb|EOX97416.1| Tubby like protein 10 isoform 1 [Theobroma cacao] gb|EOX97417.1| Tubby like protein 10 isoform 1 [Theobroma cacao] Length = 425 Score = 75.9 bits (185), Expect = 2e-12 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 115 MSFRSIARDIRDSFGSLSRRSFDVRLTGHHRGKSHGS 5 MSFRSI RD+RDSFGSLSRRSFDVRLTGHHRGKSHGS Sbjct: 1 MSFRSIVRDVRDSFGSLSRRSFDVRLTGHHRGKSHGS 37 >ref|XP_007041585.2| PREDICTED: tubby-like F-box protein 8 [Theobroma cacao] Length = 426 Score = 75.9 bits (185), Expect = 2e-12 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 115 MSFRSIARDIRDSFGSLSRRSFDVRLTGHHRGKSHGS 5 MSFRSI RD+RDSFGSLSRRSFDVRLTGHHRGKSHGS Sbjct: 1 MSFRSIVRDVRDSFGSLSRRSFDVRLTGHHRGKSHGS 37 >ref|XP_019419232.1| PREDICTED: tubby-like F-box protein 8 [Lupinus angustifolius] gb|OIV96223.1| hypothetical protein TanjilG_14900 [Lupinus angustifolius] Length = 428 Score = 75.9 bits (185), Expect = 2e-12 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 115 MSFRSIARDIRDSFGSLSRRSFDVRLTGHHRGKSHGS 5 MSFRSI RD+RDSFGSLSRRSFDVRLTGHHRGKSHGS Sbjct: 1 MSFRSIVRDVRDSFGSLSRRSFDVRLTGHHRGKSHGS 37 >ref|XP_019171591.1| PREDICTED: tubby-like F-box protein 14 [Ipomoea nil] ref|XP_019171592.1| PREDICTED: tubby-like F-box protein 14 [Ipomoea nil] ref|XP_019171593.1| PREDICTED: tubby-like F-box protein 14 [Ipomoea nil] ref|XP_019171594.1| PREDICTED: tubby-like F-box protein 14 [Ipomoea nil] Length = 430 Score = 73.9 bits (180), Expect = 7e-12 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -2 Query: 115 MSFRSIARDIRDSFGSLSRRSFDVRLTGHHRGKSHGSF 2 MSFRSI RD+RDSFGS SRRSFDVRL+GHHRG+SHGSF Sbjct: 1 MSFRSIVRDVRDSFGSFSRRSFDVRLSGHHRGRSHGSF 38 >gb|PIN05161.1| Tub family protein [Handroanthus impetiginosus] Length = 433 Score = 73.9 bits (180), Expect = 7e-12 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -2 Query: 115 MSFRSIARDIRDSFGSLSRRSFDVRLTGHHRGKSHGSF 2 MSFRSIARDIR+SFGSLSRRSFDVRL GH+RGKSHGSF Sbjct: 1 MSFRSIARDIRESFGSLSRRSFDVRLPGHYRGKSHGSF 38 >ref|XP_011092391.1| tubby-like F-box protein 8 [Sesamum indicum] ref|XP_020552978.1| tubby-like F-box protein 8 [Sesamum indicum] ref|XP_020552979.1| tubby-like F-box protein 8 [Sesamum indicum] ref|XP_020552980.1| tubby-like F-box protein 8 [Sesamum indicum] ref|XP_020552981.1| tubby-like F-box protein 8 [Sesamum indicum] Length = 434 Score = 73.9 bits (180), Expect = 7e-12 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -2 Query: 115 MSFRSIARDIRDSFGSLSRRSFDVRLTGHHRGKSHGS 5 MSFRSIARDIR+SFGSLSRRSFDVRLTGH+RGKSHGS Sbjct: 1 MSFRSIARDIRESFGSLSRRSFDVRLTGHYRGKSHGS 37 >gb|PPS16400.1| hypothetical protein GOBAR_AA04221 [Gossypium barbadense] Length = 425 Score = 73.6 bits (179), Expect = 1e-11 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -2 Query: 115 MSFRSIARDIRDSFGSLSRRSFDVRLTGHHRGKSHGS 5 MSFRSI RD+RDSFGSLSRRSFDVRL GHHRGKSHGS Sbjct: 1 MSFRSIVRDVRDSFGSLSRRSFDVRLIGHHRGKSHGS 37 >ref|XP_022762924.1| tubby-like F-box protein 8 [Durio zibethinus] ref|XP_022762925.1| tubby-like F-box protein 8 [Durio zibethinus] Length = 425 Score = 73.6 bits (179), Expect = 1e-11 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -2 Query: 115 MSFRSIARDIRDSFGSLSRRSFDVRLTGHHRGKSHGS 5 MSFRSI RD+RDSFGSLSRRSFDVRL GHHRGKSHGS Sbjct: 1 MSFRSIVRDVRDSFGSLSRRSFDVRLMGHHRGKSHGS 37 >ref|XP_019249961.1| PREDICTED: tubby-like F-box protein 8 [Nicotiana attenuata] ref|XP_019249962.1| PREDICTED: tubby-like F-box protein 8 [Nicotiana attenuata] gb|OIT00633.1| tubby-like f-box protein 8 [Nicotiana attenuata] Length = 425 Score = 73.6 bits (179), Expect = 1e-11 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -2 Query: 115 MSFRSIARDIRDSFGSLSRRSFDVRLTGHHRGKSHGSF 2 MSFRSI RD+RDSFGSLSRRSFDVRL+GH RGKSHGSF Sbjct: 1 MSFRSIVRDVRDSFGSLSRRSFDVRLSGHQRGKSHGSF 38 >ref|XP_017634078.1| PREDICTED: tubby-like F-box protein 8 [Gossypium arboreum] Length = 425 Score = 73.6 bits (179), Expect = 1e-11 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -2 Query: 115 MSFRSIARDIRDSFGSLSRRSFDVRLTGHHRGKSHGS 5 MSFRSI RD+RDSFGSLSRRSFDVRL GHHRGKSHGS Sbjct: 1 MSFRSIVRDVRDSFGSLSRRSFDVRLIGHHRGKSHGS 37 >ref|XP_012480545.1| PREDICTED: tubby-like F-box protein 8 [Gossypium raimondii] ref|XP_016691309.1| PREDICTED: tubby-like F-box protein 8 [Gossypium hirsutum] gb|KJB32749.1| hypothetical protein B456_005G259600 [Gossypium raimondii] gb|KJB32750.1| hypothetical protein B456_005G259600 [Gossypium raimondii] Length = 425 Score = 73.6 bits (179), Expect = 1e-11 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -2 Query: 115 MSFRSIARDIRDSFGSLSRRSFDVRLTGHHRGKSHGS 5 MSFRSI RD+RDSFGSLSRRSFDVRL GHHRGKSHGS Sbjct: 1 MSFRSIVRDVRDSFGSLSRRSFDVRLMGHHRGKSHGS 37 >ref|XP_009800903.1| PREDICTED: tubby-like F-box protein 8 [Nicotiana sylvestris] ref|XP_009800904.1| PREDICTED: tubby-like F-box protein 8 [Nicotiana sylvestris] ref|XP_016507159.1| PREDICTED: tubby-like F-box protein 8 [Nicotiana tabacum] Length = 425 Score = 73.6 bits (179), Expect = 1e-11 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -2 Query: 115 MSFRSIARDIRDSFGSLSRRSFDVRLTGHHRGKSHGSF 2 MSFRSI RD+RDSFGSLSRRSFDVRL+GH RGKSHGSF Sbjct: 1 MSFRSIVRDVRDSFGSLSRRSFDVRLSGHQRGKSHGSF 38 >ref|XP_016180060.1| tubby-like F-box protein 8 [Arachis ipaensis] Length = 429 Score = 73.6 bits (179), Expect = 1e-11 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -2 Query: 115 MSFRSIARDIRDSFGSLSRRSFDVRLTGHHRGKSHGS 5 MSFRSI RD+RDS GSLSRRSFDVRLTGHHRGKSHGS Sbjct: 1 MSFRSIVRDVRDSIGSLSRRSFDVRLTGHHRGKSHGS 37