BLASTX nr result
ID: Rehmannia30_contig00008711
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00008711 (956 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN18298.1| hypothetical protein CDL12_09038 [Handroanthus im... 64 1e-07 ref|XP_012829326.1| PREDICTED: probable Ufm1-specific protease [... 63 4e-07 ref|XP_011086986.1| probable Ufm1-specific protease [Sesamum ind... 60 3e-06 >gb|PIN18298.1| hypothetical protein CDL12_09038 [Handroanthus impetiginosus] Length = 656 Score = 64.3 bits (155), Expect = 1e-07 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +1 Query: 802 EKVSTIVCEDQPNN*VWDKGCMVRYELPQKLPMYYALNNPE 924 EKVST+V ED P VW KGC+VR ELP KLP+YYALNNP+ Sbjct: 147 EKVSTVVYEDWPKKDVWAKGCIVRCELPLKLPLYYALNNPK 187 >ref|XP_012829326.1| PREDICTED: probable Ufm1-specific protease [Erythranthe guttata] gb|EYU17773.1| hypothetical protein MIMGU_mgv1a002577mg [Erythranthe guttata] Length = 657 Score = 62.8 bits (151), Expect = 4e-07 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +1 Query: 802 EKVSTIVCEDQPNN*VWDKGCMVRYELPQKLPMYYALNNP 921 E+VST+V EDQP VW+KGC++R ELP KLP+YY+L NP Sbjct: 147 ERVSTVVYEDQPEREVWEKGCVIRCELPLKLPVYYSLKNP 186 >ref|XP_011086986.1| probable Ufm1-specific protease [Sesamum indicum] Length = 657 Score = 60.1 bits (144), Expect = 3e-06 Identities = 27/56 (48%), Positives = 35/56 (62%) Frame = +1 Query: 757 EMEHFGXXXXXXXXXEKVSTIVCEDQPNN*VWDKGCMVRYELPQKLPMYYALNNPE 924 ++E F EK ST+V E QP VW+KGC++R ELP LP+YYA NNP+ Sbjct: 132 DLEFFISRTGNLRNLEKASTVVYETQPEKQVWEKGCIIRCELPLNLPLYYASNNPK 187