BLASTX nr result
ID: Rehmannia30_contig00008676
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00008676 (413 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN23376.1| putative E3 ubiquitin ligase [Handroanthus impeti... 55 6e-06 >gb|PIN23376.1| putative E3 ubiquitin ligase [Handroanthus impetiginosus] Length = 363 Score = 54.7 bits (130), Expect = 6e-06 Identities = 28/45 (62%), Positives = 28/45 (62%) Frame = -1 Query: 218 MGNIGSSGVHGXXXXXXXXXXXXXXXSQAPQPEITANRYVFAAAT 84 MGNIGSSG HG QAPQPEITANRYVFAAAT Sbjct: 1 MGNIGSSGAHGRRRNSSRRSHPPPPPPQAPQPEITANRYVFAAAT 45