BLASTX nr result
ID: Rehmannia30_contig00006175
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00006175 (440 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011080784.1| pentatricopeptide repeat-containing protein ... 89 1e-17 gb|EYU45707.1| hypothetical protein MIMGU_mgv1a020921mg [Erythra... 86 1e-16 ref|XP_022857109.1| pentatricopeptide repeat-containing protein ... 86 1e-16 ref|XP_012839276.1| PREDICTED: pentatricopeptide repeat-containi... 86 1e-16 gb|PIN25446.1| hypothetical protein CDL12_01812 [Handroanthus im... 83 1e-15 gb|PIM99401.1| hypothetical protein CDL12_28106 [Handroanthus im... 83 1e-15 gb|KZV43703.1| pentatricopeptide repeat-containing protein chlor... 79 4e-14 ref|XP_016207646.1| pentatricopeptide repeat-containing protein ... 76 3e-13 ref|XP_012078864.1| pentatricopeptide repeat-containing protein ... 75 5e-13 gb|KHN15219.1| Pentatricopeptide repeat-containing protein, chlo... 74 1e-12 gb|KYP40061.1| hypothetical protein KK1_038602 [Cajanus cajan] 74 1e-12 ref|XP_003551233.1| PREDICTED: pentatricopeptide repeat-containi... 74 1e-12 ref|XP_021689234.1| pentatricopeptide repeat-containing protein ... 74 1e-12 ref|XP_021689232.1| pentatricopeptide repeat-containing protein ... 74 1e-12 ref|XP_014489680.1| pentatricopeptide repeat-containing protein ... 74 1e-12 ref|XP_017437171.1| PREDICTED: pentatricopeptide repeat-containi... 74 1e-12 ref|XP_007146808.1| hypothetical protein PHAVU_006G071400g [Phas... 74 1e-12 ref|XP_003538312.1| PREDICTED: pentatricopeptide repeat-containi... 74 1e-12 ref|XP_020202534.1| pentatricopeptide repeat-containing protein ... 74 1e-12 ref|XP_002521193.1| PREDICTED: pentatricopeptide repeat-containi... 74 2e-12 >ref|XP_011080784.1| pentatricopeptide repeat-containing protein At2g30100, chloroplastic [Sesamum indicum] Length = 502 Score = 88.6 bits (218), Expect = 1e-17 Identities = 39/45 (86%), Positives = 44/45 (97%) Frame = +2 Query: 2 RRIQQQGNLDTYLTLCKRLADANLIGPSLVYLHMRKHKLWIIKML 136 RRIQQ GN+DTY+TLCKRL+DANLIGPSLVYLH+RKHKLW+IKML Sbjct: 458 RRIQQPGNVDTYITLCKRLSDANLIGPSLVYLHLRKHKLWVIKML 502 >gb|EYU45707.1| hypothetical protein MIMGU_mgv1a020921mg [Erythranthe guttata] Length = 421 Score = 85.5 bits (210), Expect = 1e-16 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = +2 Query: 2 RRIQQQGNLDTYLTLCKRLADANLIGPSLVYLHMRKHKLWIIKML 136 RRIQ QGN+DTYLTLCKRL+DA LIGP+LVY+HMRKHKLW+IKML Sbjct: 377 RRIQLQGNVDTYLTLCKRLSDAGLIGPALVYVHMRKHKLWVIKML 421 >ref|XP_022857109.1| pentatricopeptide repeat-containing protein At2g30100, chloroplastic-like [Olea europaea var. sylvestris] Length = 503 Score = 85.5 bits (210), Expect = 1e-16 Identities = 37/45 (82%), Positives = 43/45 (95%) Frame = +2 Query: 2 RRIQQQGNLDTYLTLCKRLADANLIGPSLVYLHMRKHKLWIIKML 136 RRIQQ GN+DTYL LCKRL+DANLIGPSLVYLH++KHKLW++KML Sbjct: 459 RRIQQPGNVDTYLNLCKRLSDANLIGPSLVYLHIKKHKLWVVKML 503 >ref|XP_012839276.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30100, chloroplastic [Erythranthe guttata] Length = 511 Score = 85.5 bits (210), Expect = 1e-16 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = +2 Query: 2 RRIQQQGNLDTYLTLCKRLADANLIGPSLVYLHMRKHKLWIIKML 136 RRIQ QGN+DTYLTLCKRL+DA LIGP+LVY+HMRKHKLW+IKML Sbjct: 467 RRIQLQGNVDTYLTLCKRLSDAGLIGPALVYVHMRKHKLWVIKML 511 >gb|PIN25446.1| hypothetical protein CDL12_01812 [Handroanthus impetiginosus] Length = 500 Score = 83.2 bits (204), Expect = 1e-15 Identities = 37/45 (82%), Positives = 43/45 (95%) Frame = +2 Query: 2 RRIQQQGNLDTYLTLCKRLADANLIGPSLVYLHMRKHKLWIIKML 136 RRIQQ GN+DTYLTLCK L+DANLIGP+LVY+H+RKHKLWIIKM+ Sbjct: 456 RRIQQPGNVDTYLTLCKCLSDANLIGPTLVYMHIRKHKLWIIKMV 500 >gb|PIM99401.1| hypothetical protein CDL12_28106 [Handroanthus impetiginosus] Length = 500 Score = 83.2 bits (204), Expect = 1e-15 Identities = 37/45 (82%), Positives = 43/45 (95%) Frame = +2 Query: 2 RRIQQQGNLDTYLTLCKRLADANLIGPSLVYLHMRKHKLWIIKML 136 RRIQQ GN+DTYLTLCK L+DANLIGP+LVY+H+RKHKLWIIKM+ Sbjct: 456 RRIQQPGNVDTYLTLCKCLSDANLIGPTLVYMHIRKHKLWIIKMV 500 >gb|KZV43703.1| pentatricopeptide repeat-containing protein chloroplastic [Dorcoceras hygrometricum] Length = 502 Score = 78.6 bits (192), Expect = 4e-14 Identities = 35/45 (77%), Positives = 41/45 (91%) Frame = +2 Query: 2 RRIQQQGNLDTYLTLCKRLADANLIGPSLVYLHMRKHKLWIIKML 136 R IQQ GN+DTYLTLCK L+DANLIGP LVYLH+R++KLWI+KML Sbjct: 458 RGIQQPGNVDTYLTLCKHLSDANLIGPCLVYLHIRRYKLWILKML 502 >ref|XP_016207646.1| pentatricopeptide repeat-containing protein At2g30100, chloroplastic [Arachis ipaensis] Length = 514 Score = 76.3 bits (186), Expect = 3e-13 Identities = 33/45 (73%), Positives = 40/45 (88%) Frame = +2 Query: 2 RRIQQQGNLDTYLTLCKRLADANLIGPSLVYLHMRKHKLWIIKML 136 +RI Q GNLDTYL LCK L+DANLIGP LVYL++RK+KLW++KML Sbjct: 470 KRIHQNGNLDTYLNLCKSLSDANLIGPCLVYLYIRKYKLWVVKML 514 >ref|XP_012078864.1| pentatricopeptide repeat-containing protein At2g30100, chloroplastic [Jatropha curcas] gb|KDP45770.1| hypothetical protein JCGZ_17377 [Jatropha curcas] Length = 493 Score = 75.5 bits (184), Expect = 5e-13 Identities = 33/45 (73%), Positives = 43/45 (95%) Frame = +2 Query: 2 RRIQQQGNLDTYLTLCKRLADANLIGPSLVYLHMRKHKLWIIKML 136 +RIQQ GN+++YL LCKRL+DANLIGPSLVYL+++K+KLWI+KML Sbjct: 449 KRIQQWGNVESYLKLCKRLSDANLIGPSLVYLYIKKYKLWIMKML 493 >gb|KHN15219.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 422 Score = 74.3 bits (181), Expect = 1e-12 Identities = 32/45 (71%), Positives = 41/45 (91%) Frame = +2 Query: 2 RRIQQQGNLDTYLTLCKRLADANLIGPSLVYLHMRKHKLWIIKML 136 +RIQQ GNLDTY+ LCK L+DANLIGP LV+L++RK+KLW++KML Sbjct: 378 KRIQQYGNLDTYVRLCKSLSDANLIGPCLVHLYIRKYKLWVVKML 422 >gb|KYP40061.1| hypothetical protein KK1_038602 [Cajanus cajan] Length = 484 Score = 74.3 bits (181), Expect = 1e-12 Identities = 31/45 (68%), Positives = 41/45 (91%) Frame = +2 Query: 2 RRIQQQGNLDTYLTLCKRLADANLIGPSLVYLHMRKHKLWIIKML 136 +RIQQ GNLDTY+ LCK L+DANL+GP LV+L++RK+KLW++KML Sbjct: 440 KRIQQYGNLDTYIRLCKSLSDANLVGPCLVHLYIRKYKLWVVKML 484 >ref|XP_003551233.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30100, chloroplastic-like [Glycine max] gb|KHN02091.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] gb|KRG98246.1| hypothetical protein GLYMA_18G059800 [Glycine max] Length = 508 Score = 74.3 bits (181), Expect = 1e-12 Identities = 32/45 (71%), Positives = 41/45 (91%) Frame = +2 Query: 2 RRIQQQGNLDTYLTLCKRLADANLIGPSLVYLHMRKHKLWIIKML 136 +RIQQ GNLDTY+ LCK L+DANLIGP LV+L++RK+KLW++KML Sbjct: 464 KRIQQYGNLDTYVRLCKSLSDANLIGPCLVHLYIRKYKLWVVKML 508 >ref|XP_021689234.1| pentatricopeptide repeat-containing protein At2g30100, chloroplastic isoform X2 [Hevea brasiliensis] Length = 510 Score = 74.3 bits (181), Expect = 1e-12 Identities = 32/45 (71%), Positives = 43/45 (95%) Frame = +2 Query: 2 RRIQQQGNLDTYLTLCKRLADANLIGPSLVYLHMRKHKLWIIKML 136 +RIQQ GN+++YL LCKRL+D+NLIGPSLVYL+++K+KLWI+KML Sbjct: 466 KRIQQWGNVESYLKLCKRLSDSNLIGPSLVYLYIKKYKLWIMKML 510 >ref|XP_021689232.1| pentatricopeptide repeat-containing protein At2g30100, chloroplastic isoform X1 [Hevea brasiliensis] Length = 510 Score = 74.3 bits (181), Expect = 1e-12 Identities = 32/45 (71%), Positives = 43/45 (95%) Frame = +2 Query: 2 RRIQQQGNLDTYLTLCKRLADANLIGPSLVYLHMRKHKLWIIKML 136 +RIQQ GN+++YL LCKRL+D+NLIGPSLVYL+++K+KLWI+KML Sbjct: 466 KRIQQWGNVESYLKLCKRLSDSNLIGPSLVYLYIKKYKLWIMKML 510 >ref|XP_014489680.1| pentatricopeptide repeat-containing protein At2g30100, chloroplastic [Vigna radiata var. radiata] Length = 510 Score = 74.3 bits (181), Expect = 1e-12 Identities = 32/45 (71%), Positives = 41/45 (91%) Frame = +2 Query: 2 RRIQQQGNLDTYLTLCKRLADANLIGPSLVYLHMRKHKLWIIKML 136 +RIQQ GNLDTY+ LCK L+DANLIGP LV+L++RK+KLW++KML Sbjct: 466 KRIQQYGNLDTYVRLCKSLSDANLIGPCLVHLYIRKYKLWVVKML 510 >ref|XP_017437171.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30100, chloroplastic [Vigna angularis] gb|KOM52632.1| hypothetical protein LR48_Vigan09g129100 [Vigna angularis] dbj|BAT88309.1| hypothetical protein VIGAN_05176900 [Vigna angularis var. angularis] Length = 510 Score = 74.3 bits (181), Expect = 1e-12 Identities = 32/45 (71%), Positives = 41/45 (91%) Frame = +2 Query: 2 RRIQQQGNLDTYLTLCKRLADANLIGPSLVYLHMRKHKLWIIKML 136 +RIQQ GNLDTY+ LCK L+DANLIGP LV+L++RK+KLW++KML Sbjct: 466 KRIQQYGNLDTYVRLCKSLSDANLIGPCLVHLYIRKYKLWVVKML 510 >ref|XP_007146808.1| hypothetical protein PHAVU_006G071400g [Phaseolus vulgaris] gb|ESW18802.1| hypothetical protein PHAVU_006G071400g [Phaseolus vulgaris] Length = 510 Score = 74.3 bits (181), Expect = 1e-12 Identities = 32/45 (71%), Positives = 41/45 (91%) Frame = +2 Query: 2 RRIQQQGNLDTYLTLCKRLADANLIGPSLVYLHMRKHKLWIIKML 136 +RIQQ GNLDTY+ LCK L+DANLIGP LV+L++RK+KLW++KML Sbjct: 466 KRIQQYGNLDTYVRLCKSLSDANLIGPCLVHLYIRKYKLWVVKML 510 >ref|XP_003538312.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30100, chloroplastic-like [Glycine max] gb|KRH30204.1| hypothetical protein GLYMA_11G167300 [Glycine max] Length = 510 Score = 74.3 bits (181), Expect = 1e-12 Identities = 32/45 (71%), Positives = 41/45 (91%) Frame = +2 Query: 2 RRIQQQGNLDTYLTLCKRLADANLIGPSLVYLHMRKHKLWIIKML 136 +RIQQ GNLDTY+ LCK L+DANLIGP LV+L++RK+KLW++KML Sbjct: 466 KRIQQYGNLDTYVRLCKSLSDANLIGPCLVHLYIRKYKLWVVKML 510 >ref|XP_020202534.1| pentatricopeptide repeat-containing protein At2g30100, chloroplastic [Cajanus cajan] Length = 512 Score = 74.3 bits (181), Expect = 1e-12 Identities = 31/45 (68%), Positives = 41/45 (91%) Frame = +2 Query: 2 RRIQQQGNLDTYLTLCKRLADANLIGPSLVYLHMRKHKLWIIKML 136 +RIQQ GNLDTY+ LCK L+DANL+GP LV+L++RK+KLW++KML Sbjct: 468 KRIQQYGNLDTYIRLCKSLSDANLVGPCLVHLYIRKYKLWVVKML 512 >ref|XP_002521193.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30100, chloroplastic [Ricinus communis] gb|EEF41193.1| conserved hypothetical protein [Ricinus communis] Length = 499 Score = 73.9 bits (180), Expect = 2e-12 Identities = 32/45 (71%), Positives = 42/45 (93%) Frame = +2 Query: 2 RRIQQQGNLDTYLTLCKRLADANLIGPSLVYLHMRKHKLWIIKML 136 +RIQQ GN+++YL LCKRL+D NLIGPSLVYL+++K+KLWI+KML Sbjct: 455 KRIQQWGNVESYLNLCKRLSDENLIGPSLVYLYIKKYKLWIMKML 499