BLASTX nr result
ID: Rehmannia30_contig00005879
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00005879 (567 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011099291.1| zinc finger CCHC domain-containing protein 8... 69 4e-10 ref|XP_012852462.1| PREDICTED: zinc finger CCHC domain-containin... 61 1e-07 ref|XP_022844798.1| zinc finger CCHC domain-containing protein 8... 61 2e-07 gb|EYU44297.1| hypothetical protein MIMGU_mgv1a004282mg [Erythra... 59 6e-07 gb|KZV45598.1| hypothetical protein F511_02258 [Dorcoceras hygro... 59 9e-07 ref|XP_010247125.1| PREDICTED: uncharacterized protein LOC104590... 59 1e-06 ref|XP_009784992.1| PREDICTED: zinc finger CCHC domain-containin... 58 1e-06 ref|XP_016454459.1| PREDICTED: uncharacterized protein LOC107778... 58 2e-06 ref|XP_016447059.1| PREDICTED: uncharacterized protein LOC107772... 56 9e-06 ref|XP_009617260.1| PREDICTED: uncharacterized protein LOC104109... 56 9e-06 >ref|XP_011099291.1| zinc finger CCHC domain-containing protein 8 [Sesamum indicum] Length = 565 Score = 68.6 bits (166), Expect = 4e-10 Identities = 33/49 (67%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +2 Query: 2 SPRASPSIPWSPTYGRSFSDRGRRSPLVHD--GSPTHGQYGNFSSSSPR 142 SP+ S SIPWSP+ GRSFSDRGR+SPLV D GS +G YG F SSPR Sbjct: 517 SPQTSQSIPWSPSIGRSFSDRGRKSPLVQDRYGSSNYGHYGTFPYSSPR 565 >ref|XP_012852462.1| PREDICTED: zinc finger CCHC domain-containing protein 8-like [Erythranthe guttata] Length = 528 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/47 (63%), Positives = 31/47 (65%) Frame = +2 Query: 2 SPRASPSIPWSPTYGRSFSDRGRRSPLVHDGSPTHGQYGNFSSSSPR 142 SPR PSIPWSPTY RS SDR RRSP +GQYGN SSPR Sbjct: 488 SPRVDPSIPWSPTYARSLSDRSRRSP------SRYGQYGNLPYSSPR 528 >ref|XP_022844798.1| zinc finger CCHC domain-containing protein 8-like [Olea europaea var. sylvestris] Length = 545 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/47 (65%), Positives = 34/47 (72%) Frame = +2 Query: 2 SPRASPSIPWSPTYGRSFSDRGRRSPLVHDGSPTHGQYGNFSSSSPR 142 S R+S SIP SP+YGRS SDRGRRS LV DGS G+Y SSSPR Sbjct: 499 SARSSTSIPRSPSYGRSLSDRGRRSHLVQDGSANCGRYSTAHSSSPR 545 >gb|EYU44297.1| hypothetical protein MIMGU_mgv1a004282mg [Erythranthe guttata] Length = 535 Score = 59.3 bits (142), Expect = 6e-07 Identities = 29/46 (63%), Positives = 30/46 (65%) Frame = +2 Query: 2 SPRASPSIPWSPTYGRSFSDRGRRSPLVHDGSPTHGQYGNFSSSSP 139 SPR PSIPWSPTY RS SDR RRSP +GQYGN SSP Sbjct: 486 SPRVDPSIPWSPTYARSLSDRSRRSP------SRYGQYGNLPYSSP 525 >gb|KZV45598.1| hypothetical protein F511_02258 [Dorcoceras hygrometricum] Length = 1025 Score = 58.9 bits (141), Expect = 9e-07 Identities = 29/48 (60%), Positives = 33/48 (68%), Gaps = 1/48 (2%) Frame = +2 Query: 2 SPRASPSIPWSPTYGRSFSDRGRRSPLVHDG-SPTHGQYGNFSSSSPR 142 S + SPS+PWS T+GRS SD GRRSPL D S HG+YG FS S R Sbjct: 978 SSQVSPSMPWSSTFGRSLSDIGRRSPLAQDNDSSNHGRYGTFSYPSHR 1025 >ref|XP_010247125.1| PREDICTED: uncharacterized protein LOC104590246 [Nelumbo nucifera] Length = 594 Score = 58.5 bits (140), Expect = 1e-06 Identities = 29/54 (53%), Positives = 34/54 (62%) Frame = +2 Query: 2 SPRASPSIPWSPTYGRSFSDRGRRSPLVHDGSPTHGQYGNFSSSSPR*TFCPIN 163 SPR++ +P SP+ GR SDRGRRSPLVHDGSP Y + S SP P N Sbjct: 501 SPRSNIPVPRSPSLGRPLSDRGRRSPLVHDGSPGQSPYSSVSYPSPNARQSPQN 554 >ref|XP_009784992.1| PREDICTED: zinc finger CCHC domain-containing protein 8-like [Nicotiana sylvestris] Length = 279 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = +2 Query: 2 SPRASPSIPWSPTYGRSFSDRGRRSPLVHDGSPTHGQYGNFSSS 133 SPR S S+P SP++GRS SDRGRRSPLV+DGS H +G + +S Sbjct: 234 SPRDSASMPRSPSFGRSLSDRGRRSPLVNDGSTNHSFHGLYYTS 277 >ref|XP_016454459.1| PREDICTED: uncharacterized protein LOC107778684 [Nicotiana tabacum] Length = 535 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = +2 Query: 2 SPRASPSIPWSPTYGRSFSDRGRRSPLVHDGSPTHGQYGNFSSS 133 SPR S S+P SP++GRS SDRGRRSPLV+DGS H +G + +S Sbjct: 490 SPRDSASMPRSPSFGRSLSDRGRRSPLVNDGSTNHSFHGLYYTS 533 >ref|XP_016447059.1| PREDICTED: uncharacterized protein LOC107772086 [Nicotiana tabacum] Length = 535 Score = 55.8 bits (133), Expect = 9e-06 Identities = 26/44 (59%), Positives = 34/44 (77%) Frame = +2 Query: 2 SPRASPSIPWSPTYGRSFSDRGRRSPLVHDGSPTHGQYGNFSSS 133 SPR S S+P SP++GRS SDRGRRSPLV+DG+ H +G + +S Sbjct: 490 SPRDSASMPRSPSFGRSSSDRGRRSPLVNDGTTNHSFHGLYYTS 533 >ref|XP_009617260.1| PREDICTED: uncharacterized protein LOC104109615 [Nicotiana tomentosiformis] Length = 535 Score = 55.8 bits (133), Expect = 9e-06 Identities = 26/44 (59%), Positives = 34/44 (77%) Frame = +2 Query: 2 SPRASPSIPWSPTYGRSFSDRGRRSPLVHDGSPTHGQYGNFSSS 133 SPR S S+P SP++GRS SDRGRRSPLV+DG+ H +G + +S Sbjct: 490 SPRDSASMPRSPSFGRSSSDRGRRSPLVNDGTTNHSFHGLYYTS 533