BLASTX nr result
ID: Rehmannia30_contig00005719
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00005719 (588 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011077098.1| ribosome production factor 1 [Sesamum indicum] 62 5e-08 gb|PIN10377.1| Ribosome biogenesis protein RPF1, contains IMP4 d... 56 6e-06 >ref|XP_011077098.1| ribosome production factor 1 [Sesamum indicum] Length = 328 Score = 62.4 bits (150), Expect = 5e-08 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -3 Query: 586 YIFETKESKEPESKGKDKKDKAANPQEKVIARLQ 485 YIFETKESK+PESKGK KKDK A PQEKVIARLQ Sbjct: 253 YIFETKESKQPESKGKGKKDKDAQPQEKVIARLQ 286 >gb|PIN10377.1| Ribosome biogenesis protein RPF1, contains IMP4 domain [Handroanthus impetiginosus] Length = 328 Score = 56.2 bits (134), Expect = 6e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -3 Query: 586 YIFETKESKEPESKGKDKKDKAANPQEKVIARLQ 485 YIFETKE KE SKGK+KKDK A P+EKVIARLQ Sbjct: 253 YIFETKEDKESVSKGKEKKDKQATPKEKVIARLQ 286