BLASTX nr result
ID: Rehmannia30_contig00005584
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00005584 (676 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN05035.1| hypothetical protein CDL12_22427 [Handroanthus im... 69 4e-10 ref|XP_011074161.1| ethylene-responsive transcription factor RAP... 64 2e-08 ref|XP_022894462.1| ethylene-responsive transcription factor RAP... 57 8e-06 >gb|PIN05035.1| hypothetical protein CDL12_22427 [Handroanthus impetiginosus] Length = 348 Score = 69.3 bits (168), Expect = 4e-10 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 487 MAATMDFWSSTPVVDPFNGGELMEALEPFMKSA 585 MAATMDFWSSTPVVDPF GGELMEALEPFMKSA Sbjct: 1 MAATMDFWSSTPVVDPFRGGELMEALEPFMKSA 33 >ref|XP_011074161.1| ethylene-responsive transcription factor RAP2-13 [Sesamum indicum] Length = 330 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +1 Query: 487 MAATMDFWSSTPVVDPFNGGELMEALEPFMKSA 585 MAATMDFWSS+PVVDP GGELME LEPFMKSA Sbjct: 1 MAATMDFWSSSPVVDPLGGGELMEVLEPFMKSA 33 >ref|XP_022894462.1| ethylene-responsive transcription factor RAP2-4-like [Olea europaea var. sylvestris] Length = 327 Score = 56.6 bits (135), Expect = 8e-06 Identities = 28/34 (82%), Positives = 29/34 (85%), Gaps = 1/34 (2%) Frame = +1 Query: 487 MAATMDFWSSTP-VVDPFNGGELMEALEPFMKSA 585 MA MDFWSS+ VVDPF GGELMEALEPFMKSA Sbjct: 1 MAVAMDFWSSSASVVDPFRGGELMEALEPFMKSA 34