BLASTX nr result
ID: Rehmannia30_contig00005052
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00005052 (406 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021274574.1| ankyrin repeat domain-containing protein, ch... 82 6e-18 ref|XP_009798518.1| PREDICTED: ankyrin repeat domain-containing ... 82 1e-17 gb|PKI74434.1| hypothetical protein CRG98_005198 [Punica granatum] 81 2e-17 gb|OVA08870.1| Ankyrin repeat [Macleaya cordata] 87 2e-17 ref|XP_017697437.1| PREDICTED: ankyrin repeat domain-containing ... 86 4e-17 emb|CDP08503.1| unnamed protein product [Coffea canephora] 86 5e-17 ref|XP_008785067.1| PREDICTED: ankyrin repeat domain-containing ... 86 5e-17 ref|XP_024181618.1| ankyrin repeat domain-containing protein, ch... 86 6e-17 ref|XP_024181617.1| ankyrin repeat domain-containing protein, ch... 86 6e-17 ref|XP_012845813.1| PREDICTED: ankyrin repeat domain-containing ... 86 7e-17 gb|EOX90735.1| Ankyrin repeat protein [Theobroma cacao] 86 8e-17 ref|XP_016899287.1| PREDICTED: ankyrin repeat domain-containing ... 86 9e-17 ref|XP_016899286.1| PREDICTED: ankyrin repeat domain-containing ... 86 9e-17 gb|KGN48962.1| hypothetical protein Csa_6G507350 [Cucumis sativus] 85 1e-16 ref|XP_022132659.1| ankyrin repeat domain-containing protein, ch... 85 1e-16 ref|XP_011658501.1| PREDICTED: ankyrin repeat domain-containing ... 85 2e-16 dbj|GAV78581.1| Ank_2 domain-containing protein [Cephalotus foll... 85 2e-16 ref|XP_004233572.1| PREDICTED: ankyrin repeat domain-containing ... 85 2e-16 ref|XP_020553236.1| ankyrin repeat domain-containing protein, ch... 85 2e-16 ref|XP_011081481.1| ankyrin repeat domain-containing protein, ch... 85 2e-16 >ref|XP_021274574.1| ankyrin repeat domain-containing protein, chloroplastic-like [Herrania umbratica] Length = 92 Score = 82.4 bits (202), Expect = 6e-18 Identities = 39/51 (76%), Positives = 46/51 (90%) Frame = +2 Query: 2 RTDIVRLLLIKGADKSLKNRNGFTALDLCLYSGRDTRTYEIIKLLKTLP*P 154 RTDIV+LLLI+GADK LK+++G T LDLCLYSG+DTRTYE+IKLLK LP P Sbjct: 42 RTDIVKLLLIRGADKMLKSKDGLTPLDLCLYSGQDTRTYELIKLLKQLPKP 92 >ref|XP_009798518.1| PREDICTED: ankyrin repeat domain-containing protein, chloroplastic-like [Nicotiana sylvestris] Length = 93 Score = 81.6 bits (200), Expect = 1e-17 Identities = 39/49 (79%), Positives = 44/49 (89%) Frame = +2 Query: 2 RTDIVRLLLIKGADKSLKNRNGFTALDLCLYSGRDTRTYEIIKLLKTLP 148 RTDIVRLLLIKGADK+LKNR+G T LD+CL+ GRD RTYE+IKLLK LP Sbjct: 42 RTDIVRLLLIKGADKTLKNRDGLTPLDICLHYGRDIRTYELIKLLKQLP 90 >gb|PKI74434.1| hypothetical protein CRG98_005198 [Punica granatum] Length = 100 Score = 81.3 bits (199), Expect = 2e-17 Identities = 37/49 (75%), Positives = 46/49 (93%) Frame = +2 Query: 2 RTDIVRLLLIKGADKSLKNRNGFTALDLCLYSGRDTRTYEIIKLLKTLP 148 RTDIVRLLLIKGAD++++N++G T L+LCLYSGRD+RTYE+IKLLK LP Sbjct: 49 RTDIVRLLLIKGADRTIRNQDGLTPLELCLYSGRDSRTYELIKLLKQLP 97 >gb|OVA08870.1| Ankyrin repeat [Macleaya cordata] Length = 438 Score = 87.0 bits (214), Expect = 2e-17 Identities = 41/51 (80%), Positives = 47/51 (92%) Frame = +2 Query: 2 RTDIVRLLLIKGADKSLKNRNGFTALDLCLYSGRDTRTYEIIKLLKTLP*P 154 RTD+VRLLLIKGADK+LKN++G T LD+CLYSGRDTRTYE+IKLLK LP P Sbjct: 384 RTDLVRLLLIKGADKTLKNQDGLTPLDMCLYSGRDTRTYELIKLLKQLPKP 434 >ref|XP_017697437.1| PREDICTED: ankyrin repeat domain-containing protein, chloroplastic isoform X4 [Phoenix dactylifera] Length = 423 Score = 86.3 bits (212), Expect = 4e-17 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = +2 Query: 2 RTDIVRLLLIKGADKSLKNRNGFTALDLCLYSGRDTRTYEIIKLLKTLP 148 RTDIVRLLLIKGADK+LKNR+G T LDLCLYSGRD RTYE+IKLLK LP Sbjct: 369 RTDIVRLLLIKGADKTLKNRDGLTPLDLCLYSGRDLRTYELIKLLKGLP 417 >emb|CDP08503.1| unnamed protein product [Coffea canephora] Length = 447 Score = 86.3 bits (212), Expect = 5e-17 Identities = 40/49 (81%), Positives = 46/49 (93%) Frame = +2 Query: 2 RTDIVRLLLIKGADKSLKNRNGFTALDLCLYSGRDTRTYEIIKLLKTLP 148 RTD+VRLLLIKGADK+L+N++G T LDLCLYSGRDTRTYE+IKLLK LP Sbjct: 394 RTDVVRLLLIKGADKTLRNKDGLTPLDLCLYSGRDTRTYELIKLLKQLP 442 >ref|XP_008785067.1| PREDICTED: ankyrin repeat domain-containing protein, chloroplastic isoform X2 [Phoenix dactylifera] ref|XP_008785068.1| PREDICTED: ankyrin repeat domain-containing protein, chloroplastic isoform X1 [Phoenix dactylifera] Length = 456 Score = 86.3 bits (212), Expect = 5e-17 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = +2 Query: 2 RTDIVRLLLIKGADKSLKNRNGFTALDLCLYSGRDTRTYEIIKLLKTLP 148 RTDIVRLLLIKGADK+LKNR+G T LDLCLYSGRD RTYE+IKLLK LP Sbjct: 402 RTDIVRLLLIKGADKTLKNRDGLTPLDLCLYSGRDLRTYELIKLLKGLP 450 >ref|XP_024181618.1| ankyrin repeat domain-containing protein, chloroplastic isoform X2 [Rosa chinensis] gb|PRQ47305.1| putative ankyrin repeat-containing domain-containing protein [Rosa chinensis] Length = 419 Score = 85.9 bits (211), Expect = 6e-17 Identities = 40/49 (81%), Positives = 46/49 (93%) Frame = +2 Query: 2 RTDIVRLLLIKGADKSLKNRNGFTALDLCLYSGRDTRTYEIIKLLKTLP 148 RTD+VRLLLIKGADK+LKN++G T L+LCLYSGRDTRTYE+IKLLK LP Sbjct: 368 RTDVVRLLLIKGADKTLKNKDGLTPLELCLYSGRDTRTYELIKLLKLLP 416 >ref|XP_024181617.1| ankyrin repeat domain-containing protein, chloroplastic isoform X1 [Rosa chinensis] Length = 424 Score = 85.9 bits (211), Expect = 6e-17 Identities = 40/49 (81%), Positives = 46/49 (93%) Frame = +2 Query: 2 RTDIVRLLLIKGADKSLKNRNGFTALDLCLYSGRDTRTYEIIKLLKTLP 148 RTD+VRLLLIKGADK+LKN++G T L+LCLYSGRDTRTYE+IKLLK LP Sbjct: 373 RTDVVRLLLIKGADKTLKNKDGLTPLELCLYSGRDTRTYELIKLLKLLP 421 >ref|XP_012845813.1| PREDICTED: ankyrin repeat domain-containing protein, chloroplastic [Erythranthe guttata] gb|EYU30366.1| hypothetical protein MIMGU_mgv1a006370mg [Erythranthe guttata] Length = 446 Score = 85.9 bits (211), Expect = 7e-17 Identities = 41/51 (80%), Positives = 47/51 (92%) Frame = +2 Query: 2 RTDIVRLLLIKGADKSLKNRNGFTALDLCLYSGRDTRTYEIIKLLKTLP*P 154 RTD+VRLLLIKGADK+LKNR+G TALD+CL+SGRDTRTYE+IKLLK P P Sbjct: 392 RTDVVRLLLIKGADKTLKNRDGLTALDVCLHSGRDTRTYELIKLLKFKPLP 442 >gb|EOX90735.1| Ankyrin repeat protein [Theobroma cacao] Length = 683 Score = 85.9 bits (211), Expect = 8e-17 Identities = 41/51 (80%), Positives = 46/51 (90%) Frame = +2 Query: 2 RTDIVRLLLIKGADKSLKNRNGFTALDLCLYSGRDTRTYEIIKLLKTLP*P 154 RTDIV+LLLI+GADK LKN++G T LDLCLYSGRDTRTYE+IKLLK LP P Sbjct: 632 RTDIVKLLLIRGADKMLKNKDGLTPLDLCLYSGRDTRTYELIKLLKQLPKP 682 >ref|XP_016899287.1| PREDICTED: ankyrin repeat domain-containing protein, chloroplastic isoform X2 [Cucumis melo] Length = 436 Score = 85.5 bits (210), Expect = 9e-17 Identities = 41/52 (78%), Positives = 46/52 (88%) Frame = +2 Query: 2 RTDIVRLLLIKGADKSLKNRNGFTALDLCLYSGRDTRTYEIIKLLKTLP*PS 157 RTDIVRLLLIKGADK+LKN G T LD+CLYSG+DT+TYE+IKLLK LP PS Sbjct: 381 RTDIVRLLLIKGADKTLKNAGGLTPLDICLYSGQDTKTYELIKLLKQLPRPS 432 >ref|XP_016899286.1| PREDICTED: ankyrin repeat domain-containing protein, chloroplastic isoform X1 [Cucumis melo] Length = 453 Score = 85.5 bits (210), Expect = 9e-17 Identities = 41/52 (78%), Positives = 46/52 (88%) Frame = +2 Query: 2 RTDIVRLLLIKGADKSLKNRNGFTALDLCLYSGRDTRTYEIIKLLKTLP*PS 157 RTDIVRLLLIKGADK+LKN G T LD+CLYSG+DT+TYE+IKLLK LP PS Sbjct: 398 RTDIVRLLLIKGADKTLKNAGGLTPLDICLYSGQDTKTYELIKLLKQLPRPS 449 >gb|KGN48962.1| hypothetical protein Csa_6G507350 [Cucumis sativus] Length = 431 Score = 85.1 bits (209), Expect = 1e-16 Identities = 40/52 (76%), Positives = 46/52 (88%) Frame = +2 Query: 2 RTDIVRLLLIKGADKSLKNRNGFTALDLCLYSGRDTRTYEIIKLLKTLP*PS 157 RTD+VRLLLIKGADK+LKN G T LD+CLYSG+DT+TYE+IKLLK LP PS Sbjct: 376 RTDVVRLLLIKGADKTLKNAEGLTPLDICLYSGQDTKTYELIKLLKQLPRPS 427 >ref|XP_022132659.1| ankyrin repeat domain-containing protein, chloroplastic [Momordica charantia] Length = 529 Score = 85.1 bits (209), Expect = 1e-16 Identities = 40/52 (76%), Positives = 46/52 (88%) Frame = +2 Query: 2 RTDIVRLLLIKGADKSLKNRNGFTALDLCLYSGRDTRTYEIIKLLKTLP*PS 157 RTD+VRLLLIKGADK+LKN G T LDLCLYSG+DT+TYE++KLLK LP PS Sbjct: 474 RTDVVRLLLIKGADKTLKNAEGLTPLDLCLYSGQDTKTYELLKLLKQLPKPS 525 >ref|XP_011658501.1| PREDICTED: ankyrin repeat domain-containing protein, chloroplastic [Cucumis sativus] Length = 700 Score = 85.1 bits (209), Expect = 2e-16 Identities = 40/52 (76%), Positives = 46/52 (88%) Frame = +2 Query: 2 RTDIVRLLLIKGADKSLKNRNGFTALDLCLYSGRDTRTYEIIKLLKTLP*PS 157 RTD+VRLLLIKGADK+LKN G T LD+CLYSG+DT+TYE+IKLLK LP PS Sbjct: 645 RTDVVRLLLIKGADKTLKNAEGLTPLDICLYSGQDTKTYELIKLLKQLPRPS 696 >dbj|GAV78581.1| Ank_2 domain-containing protein [Cephalotus follicularis] Length = 425 Score = 84.7 bits (208), Expect = 2e-16 Identities = 41/49 (83%), Positives = 44/49 (89%) Frame = +2 Query: 2 RTDIVRLLLIKGADKSLKNRNGFTALDLCLYSGRDTRTYEIIKLLKTLP 148 RTD VRLLLIKGADK+LKNR+G T LDLCLYSGR TRTYE+IKLLK LP Sbjct: 374 RTDAVRLLLIKGADKTLKNRDGLTPLDLCLYSGRSTRTYELIKLLKQLP 422 >ref|XP_004233572.1| PREDICTED: ankyrin repeat domain-containing protein, chloroplastic [Solanum lycopersicum] Length = 453 Score = 84.7 bits (208), Expect = 2e-16 Identities = 41/54 (75%), Positives = 48/54 (88%) Frame = +2 Query: 2 RTDIVRLLLIKGADKSLKNRNGFTALDLCLYSGRDTRTYEIIKLLKTLP*PSVI 163 RTDIVRLLLIKGADK+LKNR+G T LD+CL+SGRD RTYE+IKLLK LP S++ Sbjct: 397 RTDIVRLLLIKGADKTLKNRDGLTPLDICLHSGRDIRTYELIKLLKQLPKVSLV 450 >ref|XP_020553236.1| ankyrin repeat domain-containing protein, chloroplastic isoform X2 [Sesamum indicum] Length = 472 Score = 84.7 bits (208), Expect = 2e-16 Identities = 40/49 (81%), Positives = 44/49 (89%) Frame = +2 Query: 2 RTDIVRLLLIKGADKSLKNRNGFTALDLCLYSGRDTRTYEIIKLLKTLP 148 RTD+VRLLLIKGADK+LKNR+G T LDLCLY GRDTRTYE+IKLLK P Sbjct: 424 RTDVVRLLLIKGADKTLKNRDGLTPLDLCLYFGRDTRTYELIKLLKRFP 472 >ref|XP_011081481.1| ankyrin repeat domain-containing protein, chloroplastic isoform X1 [Sesamum indicum] Length = 473 Score = 84.7 bits (208), Expect = 2e-16 Identities = 40/49 (81%), Positives = 44/49 (89%) Frame = +2 Query: 2 RTDIVRLLLIKGADKSLKNRNGFTALDLCLYSGRDTRTYEIIKLLKTLP 148 RTD+VRLLLIKGADK+LKNR+G T LDLCLY GRDTRTYE+IKLLK P Sbjct: 425 RTDVVRLLLIKGADKTLKNRDGLTPLDLCLYFGRDTRTYELIKLLKRFP 473