BLASTX nr result
ID: Rehmannia30_contig00003020
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00003020 (642 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN12437.1| hypothetical protein CDL12_14949 [Handroanthus im... 56 9e-06 >gb|PIN12437.1| hypothetical protein CDL12_14949 [Handroanthus impetiginosus] Length = 333 Score = 56.2 bits (134), Expect = 9e-06 Identities = 29/45 (64%), Positives = 30/45 (66%) Frame = +3 Query: 3 RSRTEQSKRWAPAAGVGNYRSEAXXXXXXXXXXXPDDARRKRFKD 137 RSR EQSKRW PA GVGNYRSEA P DARRKRF+D Sbjct: 290 RSRAEQSKRWMPATGVGNYRSEASRRQSHVSRLSP-DARRKRFRD 333