BLASTX nr result
ID: Rehmannia30_contig00001607
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00001607 (542 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011076709.1| omega-3 fatty acid desaturase, chloroplastic... 153 3e-41 ref|XP_009797152.1| PREDICTED: omega-3 fatty acid desaturase, ch... 150 8e-41 gb|PKI46673.1| hypothetical protein CRG98_033015 [Punica granatum] 144 1e-40 ref|XP_012850087.1| PREDICTED: omega-3 fatty acid desaturase, ch... 151 2e-40 ref|XP_019260111.1| PREDICTED: omega-3 fatty acid desaturase, ch... 150 2e-40 ref|XP_016515722.1| PREDICTED: omega-3 fatty acid desaturase, ch... 150 3e-40 ref|XP_016486932.1| PREDICTED: omega-3 fatty acid desaturase, ch... 150 3e-40 ref|XP_009594369.1| PREDICTED: omega-3 fatty acid desaturase, ch... 150 3e-40 gb|KJB74348.1| hypothetical protein B456_011G289600 [Gossypium r... 150 4e-40 gb|KJB74349.1| hypothetical protein B456_011G289600 [Gossypium r... 150 5e-40 gb|PPS02326.1| hypothetical protein GOBAR_AA18340 [Gossypium bar... 150 6e-40 gb|PPD76047.1| hypothetical protein GOBAR_DD27037 [Gossypium bar... 150 6e-40 ref|NP_001296282.1| omega-3 fatty acid desaturase, chloroplastic... 150 6e-40 ref|XP_017620049.1| PREDICTED: omega-3 fatty acid desaturase, ch... 150 6e-40 gb|AIC85620.1| fatty acid desaturase-like protein 1, partial [Pe... 148 1e-39 gb|ALA55534.1| omega-3 fatty acid desaturase [Perilla frutescens... 149 1e-39 gb|ATG80698.1| omega-3 fatty acid desaturase [Perilla frutescens... 148 2e-39 ref|NP_001312286.1| omega-3 fatty acid desaturase, chloroplastic... 148 3e-39 ref|NP_001313206.1| omega-3 fatty acid desaturase, chloroplastic... 148 3e-39 gb|EPS73562.1| hypothetical protein M569_01192, partial [Genlise... 145 4e-39 >ref|XP_011076709.1| omega-3 fatty acid desaturase, chloroplastic [Sesamum indicum] Length = 436 Score = 153 bits (386), Expect = 3e-41 Identities = 70/72 (97%), Positives = 72/72 (100%) Frame = +3 Query: 3 VIHHLFPQIPHYHLIEATEAAKPVLGKYYREPQKSGPLPFYLLGVLLRSMKKDHYVSDTG 182 VIHHLFPQIPHYHLIEATEAAKPVLGKYYREPQKSGPLPFYLLGVLLRSMKKDHYVSDTG Sbjct: 365 VIHHLFPQIPHYHLIEATEAAKPVLGKYYREPQKSGPLPFYLLGVLLRSMKKDHYVSDTG 424 Query: 183 DIVYYQTDPQLN 218 D+VYYQTDP+LN Sbjct: 425 DVVYYQTDPELN 436 >ref|XP_009797152.1| PREDICTED: omega-3 fatty acid desaturase, chloroplastic-like [Nicotiana sylvestris] Length = 382 Score = 150 bits (380), Expect = 8e-41 Identities = 67/76 (88%), Positives = 75/76 (98%) Frame = +3 Query: 3 VIHHLFPQIPHYHLIEATEAAKPVLGKYYREPQKSGPLPFYLLGVLLRSMKKDHYVSDTG 182 VIHHLFPQIPHYHL+EATEAAKPVLGKYY+EP+KSGPLPFYLLGVL++SMK+DHYVSDTG Sbjct: 307 VIHHLFPQIPHYHLVEATEAAKPVLGKYYKEPKKSGPLPFYLLGVLIKSMKQDHYVSDTG 366 Query: 183 DIVYYQTDPQLNGAHK 230 DIVYYQTDPQL+G+ K Sbjct: 367 DIVYYQTDPQLSGSQK 382 >gb|PKI46673.1| hypothetical protein CRG98_033015 [Punica granatum] Length = 160 Score = 144 bits (362), Expect = 1e-40 Identities = 65/77 (84%), Positives = 73/77 (94%) Frame = +3 Query: 3 VIHHLFPQIPHYHLIEATEAAKPVLGKYYREPQKSGPLPFYLLGVLLRSMKKDHYVSDTG 182 VIHHLFPQIPHYHLIEATEAAKPVLGKYY+EP+KSGPLPF+LLGVLL+SMK+DHYVSD+G Sbjct: 83 VIHHLFPQIPHYHLIEATEAAKPVLGKYYKEPKKSGPLPFHLLGVLLKSMKEDHYVSDSG 142 Query: 183 DIVYYQTDPQLNGAHKS 233 D+VYYQ DPQL G+ S Sbjct: 143 DVVYYQRDPQLFGSESS 159 >ref|XP_012850087.1| PREDICTED: omega-3 fatty acid desaturase, chloroplastic-like [Erythranthe guttata] gb|EYU26787.1| hypothetical protein MIMGU_mgv1a006242mg [Erythranthe guttata] Length = 451 Score = 151 bits (381), Expect = 2e-40 Identities = 68/77 (88%), Positives = 76/77 (98%) Frame = +3 Query: 3 VIHHLFPQIPHYHLIEATEAAKPVLGKYYREPQKSGPLPFYLLGVLLRSMKKDHYVSDTG 182 VIHHLFPQIPHY+LIEATEAAKPVLGKYY+EP+KS P+PFYLLGVL+RS+KKDHYVSDTG Sbjct: 375 VIHHLFPQIPHYNLIEATEAAKPVLGKYYKEPKKSSPIPFYLLGVLVRSLKKDHYVSDTG 434 Query: 183 DIVYYQTDPQLNGAHKS 233 DIVYYQTDPQL+G+HKS Sbjct: 435 DIVYYQTDPQLSGSHKS 451 >ref|XP_019260111.1| PREDICTED: omega-3 fatty acid desaturase, chloroplastic [Nicotiana attenuata] gb|OIT39409.1| omega-3 fatty acid desaturase, chloroplastic [Nicotiana attenuata] Length = 438 Score = 150 bits (380), Expect = 2e-40 Identities = 67/76 (88%), Positives = 75/76 (98%) Frame = +3 Query: 3 VIHHLFPQIPHYHLIEATEAAKPVLGKYYREPQKSGPLPFYLLGVLLRSMKKDHYVSDTG 182 VIHHLFPQIPHYHL+EATEAAKPVLGKYY+EP+KSGPLPFYLLGVL++SMK+DHYVSDTG Sbjct: 363 VIHHLFPQIPHYHLVEATEAAKPVLGKYYKEPKKSGPLPFYLLGVLIKSMKQDHYVSDTG 422 Query: 183 DIVYYQTDPQLNGAHK 230 DIVYYQTDPQL+G+ K Sbjct: 423 DIVYYQTDPQLSGSQK 438 >ref|XP_016515722.1| PREDICTED: omega-3 fatty acid desaturase, chloroplastic-like [Nicotiana tabacum] Length = 442 Score = 150 bits (380), Expect = 3e-40 Identities = 67/76 (88%), Positives = 75/76 (98%) Frame = +3 Query: 3 VIHHLFPQIPHYHLIEATEAAKPVLGKYYREPQKSGPLPFYLLGVLLRSMKKDHYVSDTG 182 VIHHLFPQIPHYHL+EATEAAKPVLGKYY+EP+KSGPLPFYLLGVL++SMK+DHYVSDTG Sbjct: 367 VIHHLFPQIPHYHLVEATEAAKPVLGKYYKEPKKSGPLPFYLLGVLIKSMKQDHYVSDTG 426 Query: 183 DIVYYQTDPQLNGAHK 230 DIVYYQTDPQL+G+ K Sbjct: 427 DIVYYQTDPQLSGSQK 442 >ref|XP_016486932.1| PREDICTED: omega-3 fatty acid desaturase, chloroplastic-like [Nicotiana tabacum] Length = 442 Score = 150 bits (380), Expect = 3e-40 Identities = 67/76 (88%), Positives = 75/76 (98%) Frame = +3 Query: 3 VIHHLFPQIPHYHLIEATEAAKPVLGKYYREPQKSGPLPFYLLGVLLRSMKKDHYVSDTG 182 VIHHLFPQIPHYHL+EATEAAKPVLGKYY+EP+KSGPLPFYLLGVL++SMK+DHYVSDTG Sbjct: 367 VIHHLFPQIPHYHLVEATEAAKPVLGKYYKEPKKSGPLPFYLLGVLIKSMKQDHYVSDTG 426 Query: 183 DIVYYQTDPQLNGAHK 230 DIVYYQTDPQL+G+ K Sbjct: 427 DIVYYQTDPQLSGSQK 442 >ref|XP_009594369.1| PREDICTED: omega-3 fatty acid desaturase, chloroplastic [Nicotiana tomentosiformis] Length = 442 Score = 150 bits (380), Expect = 3e-40 Identities = 67/76 (88%), Positives = 75/76 (98%) Frame = +3 Query: 3 VIHHLFPQIPHYHLIEATEAAKPVLGKYYREPQKSGPLPFYLLGVLLRSMKKDHYVSDTG 182 VIHHLFPQIPHYHL+EATEAAKPVLGKYY+EP+KSGPLPFYLLGVL++SMK+DHYVSDTG Sbjct: 367 VIHHLFPQIPHYHLVEATEAAKPVLGKYYKEPKKSGPLPFYLLGVLIKSMKQDHYVSDTG 426 Query: 183 DIVYYQTDPQLNGAHK 230 DIVYYQTDPQL+G+ K Sbjct: 427 DIVYYQTDPQLSGSQK 442 >gb|KJB74348.1| hypothetical protein B456_011G289600 [Gossypium raimondii] Length = 425 Score = 150 bits (378), Expect = 4e-40 Identities = 67/77 (87%), Positives = 74/77 (96%) Frame = +3 Query: 3 VIHHLFPQIPHYHLIEATEAAKPVLGKYYREPQKSGPLPFYLLGVLLRSMKKDHYVSDTG 182 VIHHLFPQIPHYHLIEATEAAKPVLGKYYREP+KSGPLPFYLLG+L++SM+KDHYVSD G Sbjct: 348 VIHHLFPQIPHYHLIEATEAAKPVLGKYYREPKKSGPLPFYLLGILIKSMRKDHYVSDIG 407 Query: 183 DIVYYQTDPQLNGAHKS 233 D+VYYQTDPQL G +KS Sbjct: 408 DVVYYQTDPQLYGTNKS 424 >gb|KJB74349.1| hypothetical protein B456_011G289600 [Gossypium raimondii] Length = 437 Score = 150 bits (378), Expect = 5e-40 Identities = 67/77 (87%), Positives = 74/77 (96%) Frame = +3 Query: 3 VIHHLFPQIPHYHLIEATEAAKPVLGKYYREPQKSGPLPFYLLGVLLRSMKKDHYVSDTG 182 VIHHLFPQIPHYHLIEATEAAKPVLGKYYREP+KSGPLPFYLLG+L++SM+KDHYVSD G Sbjct: 360 VIHHLFPQIPHYHLIEATEAAKPVLGKYYREPKKSGPLPFYLLGILIKSMRKDHYVSDIG 419 Query: 183 DIVYYQTDPQLNGAHKS 233 D+VYYQTDPQL G +KS Sbjct: 420 DVVYYQTDPQLYGTNKS 436 >gb|PPS02326.1| hypothetical protein GOBAR_AA18340 [Gossypium barbadense] Length = 449 Score = 150 bits (378), Expect = 6e-40 Identities = 67/77 (87%), Positives = 74/77 (96%) Frame = +3 Query: 3 VIHHLFPQIPHYHLIEATEAAKPVLGKYYREPQKSGPLPFYLLGVLLRSMKKDHYVSDTG 182 VIHHLFPQIPHYHLIEATEAAKPVLGKYYREP+KSGPLPFYLLG+L++SM+KDHYVSD G Sbjct: 372 VIHHLFPQIPHYHLIEATEAAKPVLGKYYREPKKSGPLPFYLLGILIKSMRKDHYVSDIG 431 Query: 183 DIVYYQTDPQLNGAHKS 233 D+VYYQTDPQL G +KS Sbjct: 432 DVVYYQTDPQLYGTNKS 448 >gb|PPD76047.1| hypothetical protein GOBAR_DD27037 [Gossypium barbadense] Length = 449 Score = 150 bits (378), Expect = 6e-40 Identities = 67/77 (87%), Positives = 74/77 (96%) Frame = +3 Query: 3 VIHHLFPQIPHYHLIEATEAAKPVLGKYYREPQKSGPLPFYLLGVLLRSMKKDHYVSDTG 182 VIHHLFPQIPHYHLIEATEAAKPVLGKYYREP+KSGPLPFYLLG+L++SM+KDHYVSD G Sbjct: 372 VIHHLFPQIPHYHLIEATEAAKPVLGKYYREPKKSGPLPFYLLGILIKSMRKDHYVSDIG 431 Query: 183 DIVYYQTDPQLNGAHKS 233 D+VYYQTDPQL G +KS Sbjct: 432 DVVYYQTDPQLYGTNKS 448 >ref|NP_001296282.1| omega-3 fatty acid desaturase, chloroplastic-like [Gossypium raimondii] gb|AIY68493.1| chloroplast omega-3 fatty acid desaturase [Gossypium raimondii] gb|AIY68494.1| chloroplast omega-3 fatty acid desaturase [Gossypium raimondii] gb|KJB74347.1| hypothetical protein B456_011G289600 [Gossypium raimondii] Length = 450 Score = 150 bits (378), Expect = 6e-40 Identities = 67/77 (87%), Positives = 74/77 (96%) Frame = +3 Query: 3 VIHHLFPQIPHYHLIEATEAAKPVLGKYYREPQKSGPLPFYLLGVLLRSMKKDHYVSDTG 182 VIHHLFPQIPHYHLIEATEAAKPVLGKYYREP+KSGPLPFYLLG+L++SM+KDHYVSD G Sbjct: 373 VIHHLFPQIPHYHLIEATEAAKPVLGKYYREPKKSGPLPFYLLGILIKSMRKDHYVSDIG 432 Query: 183 DIVYYQTDPQLNGAHKS 233 D+VYYQTDPQL G +KS Sbjct: 433 DVVYYQTDPQLYGTNKS 449 >ref|XP_017620049.1| PREDICTED: omega-3 fatty acid desaturase, chloroplastic-like [Gossypium arboreum] gb|AIY68461.1| chloroplast omega-3 fatty acid desaturase [Gossypium herbaceum] gb|AIY68462.1| chloroplast omega-3 fatty acid desaturase [Gossypium herbaceum] gb|AIY68479.1| chloroplast omega-3 fatty acid desaturase [Gossypium hirsutum] gb|AIY68480.1| endoplasmic reticulum-localized omega-3 fatty acid desaturase [Gossypium hirsutum] gb|KHG02705.1| Omega-3 fatty acid desaturase, chloroplastic [Gossypium arboreum] Length = 450 Score = 150 bits (378), Expect = 6e-40 Identities = 67/77 (87%), Positives = 74/77 (96%) Frame = +3 Query: 3 VIHHLFPQIPHYHLIEATEAAKPVLGKYYREPQKSGPLPFYLLGVLLRSMKKDHYVSDTG 182 VIHHLFPQIPHYHLIEATEAAKPVLGKYYREP+KSGPLPFYLLG+L++SM+KDHYVSD G Sbjct: 373 VIHHLFPQIPHYHLIEATEAAKPVLGKYYREPKKSGPLPFYLLGILIKSMRKDHYVSDIG 432 Query: 183 DIVYYQTDPQLNGAHKS 233 D+VYYQTDPQL G +KS Sbjct: 433 DVVYYQTDPQLYGTNKS 449 >gb|AIC85620.1| fatty acid desaturase-like protein 1, partial [Perilla frutescens var. frutescens] Length = 408 Score = 148 bits (374), Expect = 1e-39 Identities = 70/77 (90%), Positives = 72/77 (93%) Frame = +3 Query: 3 VIHHLFPQIPHYHLIEATEAAKPVLGKYYREPQKSGPLPFYLLGVLLRSMKKDHYVSDTG 182 VIHHLFPQIPHYHLIEATEAAK VLGKYYREP+KSGPLP +LLG LLRSMKKDHYVSDTG Sbjct: 332 VIHHLFPQIPHYHLIEATEAAKGVLGKYYREPKKSGPLPLHLLGDLLRSMKKDHYVSDTG 391 Query: 183 DIVYYQTDPQLNGAHKS 233 DIVYYQTDPQLNG KS Sbjct: 392 DIVYYQTDPQLNGGRKS 408 >gb|ALA55534.1| omega-3 fatty acid desaturase [Perilla frutescens var. frutescens] gb|AQZ42318.1| fatty acid desaturase [Perilla citriodora] Length = 438 Score = 149 bits (375), Expect = 1e-39 Identities = 70/77 (90%), Positives = 72/77 (93%) Frame = +3 Query: 3 VIHHLFPQIPHYHLIEATEAAKPVLGKYYREPQKSGPLPFYLLGVLLRSMKKDHYVSDTG 182 VIHHLFPQIPHYHLIEATEAAK VLGKYYREP+KSGPLP +LLG LLRSMKKDHYVSDTG Sbjct: 362 VIHHLFPQIPHYHLIEATEAAKGVLGKYYREPKKSGPLPLHLLGELLRSMKKDHYVSDTG 421 Query: 183 DIVYYQTDPQLNGAHKS 233 DIVYYQTDPQLNG KS Sbjct: 422 DIVYYQTDPQLNGGRKS 438 >gb|ATG80698.1| omega-3 fatty acid desaturase [Perilla frutescens] gb|ATG80699.1| omega-3 fatty acid desaturase [Perilla frutescens] Length = 438 Score = 148 bits (374), Expect = 2e-39 Identities = 70/77 (90%), Positives = 72/77 (93%) Frame = +3 Query: 3 VIHHLFPQIPHYHLIEATEAAKPVLGKYYREPQKSGPLPFYLLGVLLRSMKKDHYVSDTG 182 VIHHLFPQIPHYHLIEATEAAK VLGKYYREP+KSGPLP +LLG LLRSMKKDHYVSDTG Sbjct: 362 VIHHLFPQIPHYHLIEATEAAKGVLGKYYREPKKSGPLPLHLLGDLLRSMKKDHYVSDTG 421 Query: 183 DIVYYQTDPQLNGAHKS 233 DIVYYQTDPQLNG KS Sbjct: 422 DIVYYQTDPQLNGGRKS 438 >ref|NP_001312286.1| omega-3 fatty acid desaturase, chloroplastic-like [Nicotiana tabacum] ref|XP_009797474.1| PREDICTED: omega-3 fatty acid desaturase, chloroplastic-like [Nicotiana sylvestris] dbj|BAA11475.1| omega-3 fatty acid desaturase [Nicotiana tabacum] dbj|BAC01274.1| plastid omega-3 fatty acid desaturase [Nicotiana tabacum] Length = 441 Score = 148 bits (373), Expect = 3e-39 Identities = 66/76 (86%), Positives = 74/76 (97%) Frame = +3 Query: 3 VIHHLFPQIPHYHLIEATEAAKPVLGKYYREPQKSGPLPFYLLGVLLRSMKKDHYVSDTG 182 VIHHLFPQIPHYHL+EATEAAKPVLGKYY+EP+KSGPLPFYLLGVL++SMK+DHYVSDTG Sbjct: 366 VIHHLFPQIPHYHLVEATEAAKPVLGKYYKEPKKSGPLPFYLLGVLIKSMKQDHYVSDTG 425 Query: 183 DIVYYQTDPQLNGAHK 230 DIVYY+TDPQL+G K Sbjct: 426 DIVYYRTDPQLSGFQK 441 >ref|NP_001313206.1| omega-3 fatty acid desaturase, chloroplastic-like [Nicotiana tabacum] gb|AIA22325.1| fatty acid desaturase 7 [Nicotiana tabacum] Length = 442 Score = 148 bits (373), Expect = 3e-39 Identities = 66/76 (86%), Positives = 74/76 (97%) Frame = +3 Query: 3 VIHHLFPQIPHYHLIEATEAAKPVLGKYYREPQKSGPLPFYLLGVLLRSMKKDHYVSDTG 182 VIHHLFPQIPHYHL+EATEAAKPVLGKYY+EP+KSGPLPFYLLGVL++SMK+DHYVSDTG Sbjct: 367 VIHHLFPQIPHYHLVEATEAAKPVLGKYYKEPKKSGPLPFYLLGVLIKSMKQDHYVSDTG 426 Query: 183 DIVYYQTDPQLNGAHK 230 DIVYY+TDPQL+G K Sbjct: 427 DIVYYRTDPQLSGFQK 442 >gb|EPS73562.1| hypothetical protein M569_01192, partial [Genlisea aurea] Length = 351 Score = 145 bits (367), Expect = 4e-39 Identities = 66/72 (91%), Positives = 71/72 (98%) Frame = +3 Query: 3 VIHHLFPQIPHYHLIEATEAAKPVLGKYYREPQKSGPLPFYLLGVLLRSMKKDHYVSDTG 182 VIHHLFPQIPHYHLIEATEAAKPVLG+YYREP KSGPLPF+LLG+LLRSM+KDHYVSDTG Sbjct: 280 VIHHLFPQIPHYHLIEATEAAKPVLGEYYREPAKSGPLPFHLLGILLRSMRKDHYVSDTG 339 Query: 183 DIVYYQTDPQLN 218 DIVYYQTDP+LN Sbjct: 340 DIVYYQTDPKLN 351