BLASTX nr result
ID: Rehmannia30_contig00000016
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00000016 (462 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011090546.1| TLD domain-containing protein 2 [Sesamum ind... 60 2e-07 >ref|XP_011090546.1| TLD domain-containing protein 2 [Sesamum indicum] Length = 385 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 91 AAHFVSDITTVLLNPISDKPSTPPPQPSSH 2 A HFVSD+TTVLLNPISDKPS PPP+PSSH Sbjct: 24 AVHFVSDLTTVLLNPISDKPSKPPPKPSSH 53