BLASTX nr result
ID: Rehmannia29_contig00039339
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00039339 (540 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZV22124.1| hypothetical protein F511_11652 [Dorcoceras hygro... 65 2e-09 ref|XP_011073037.1| uncharacterized protein LOC105158097 [Sesamu... 60 2e-07 ref|XP_011100917.1| uncharacterized protein LOC105179028 [Sesamu... 56 2e-06 >gb|KZV22124.1| hypothetical protein F511_11652 [Dorcoceras hygrometricum] Length = 277 Score = 65.5 bits (158), Expect = 2e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 96 SYNLEPFNGKTDFSIWQQKMKGILIQQKVYK 4 +Y+LEPFNGKTDFSIWQQKMKGILIQQKVYK Sbjct: 6 AYHLEPFNGKTDFSIWQQKMKGILIQQKVYK 36 >ref|XP_011073037.1| uncharacterized protein LOC105158097 [Sesamum indicum] Length = 472 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -1 Query: 93 YNLEPFNGKTDFSIWQQKMKGILIQQKVYK 4 Y+L+PF+GKTDFSIWQQKMKGILIQQKV+K Sbjct: 4 YSLQPFDGKTDFSIWQQKMKGILIQQKVFK 33 >ref|XP_011100917.1| uncharacterized protein LOC105179028 [Sesamum indicum] Length = 188 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -1 Query: 93 YNLEPFNGKTDFSIWQQKMKGILIQQKVYK 4 Y+L+ F+GK+DFSIWQQKMKGILIQQKV+K Sbjct: 4 YSLQSFDGKSDFSIWQQKMKGILIQQKVFK 33