BLASTX nr result
ID: Rehmannia29_contig00038981
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00038981 (473 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN01686.1| hypothetical protein CDL12_25807 [Handroanthus im... 94 2e-19 ref|XP_022874523.1| uncharacterized protein LOC111393293 [Olea e... 75 1e-13 >gb|PIN01686.1| hypothetical protein CDL12_25807 [Handroanthus impetiginosus] Length = 385 Score = 93.6 bits (231), Expect = 2e-19 Identities = 46/75 (61%), Positives = 54/75 (72%), Gaps = 3/75 (4%) Frame = +1 Query: 112 DFPRGEGFVPLPPKVNEMPLT---DNSSIVEGNPILNSSPMPMLSIPERWDYLTSDGGNA 282 DFPR + VPLPPKVNEMPL DNSS V+ NP + SP P IPERW++L+SDGGN Sbjct: 306 DFPRDDTVVPLPPKVNEMPLNSRGDNSSTVDSNPTFSGSPQPKQGIPERWNHLSSDGGNV 365 Query: 283 KMLLNSRILLMIVSF 327 KMLL SR LL++ F Sbjct: 366 KMLLYSRNLLILALF 380 >ref|XP_022874523.1| uncharacterized protein LOC111393293 [Olea europaea var. sylvestris] Length = 239 Score = 75.5 bits (184), Expect = 1e-13 Identities = 36/71 (50%), Positives = 50/71 (70%), Gaps = 3/71 (4%) Frame = +1 Query: 133 FVPLPPKVNEMPLTD---NSSIVEGNPILNSSPMPMLSIPERWDYLTSDGGNAKMLLNSR 303 FVPLPPKV E+P NS+IV+G P LNS+ +P LSIP+RWDY+++ + K+ L R Sbjct: 169 FVPLPPKVREIPRNSTPGNSTIVDGEPTLNSNTVPKLSIPDRWDYVSAYAADMKICLQLR 228 Query: 304 ILLMIVSFCMY 336 ILL++ F +Y Sbjct: 229 ILLLVALFYVY 239