BLASTX nr result
ID: Rehmannia29_contig00038591
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00038591 (971 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35552.1| hypothetical protein MIMGU_mgv1a015659mg [Erythra... 69 2e-10 >gb|EYU35552.1| hypothetical protein MIMGU_mgv1a015659mg [Erythranthe guttata] Length = 150 Score = 68.6 bits (166), Expect = 2e-10 Identities = 39/97 (40%), Positives = 53/97 (54%), Gaps = 4/97 (4%) Frame = +1 Query: 469 ADTRARLAREFNYSISDDENKPIRLIIKCITGHPTPIPPRNCNVAFNGMPYNIGDFPPND 648 A T ++ E +S D + L +K GHP P PP NV F+ YN+ PP+ Sbjct: 33 APTEEQMLNEHRRLVSIDRAQT--LSVKEFPGHPFPQPPAVQNVVFDNNNYNVNTSPPDH 90 Query: 649 LLPTTLSELRAVNSVSI----QRMRAIDWFYNDPRLA 747 L+P L L AV++ ++ R+RAI WFYNDPRLA Sbjct: 91 LIPADLHALHAVSTGTVVLARDRLRAIYWFYNDPRLA 127