BLASTX nr result
ID: Rehmannia29_contig00038542
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00038542 (543 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_398873.1| hypothetical protein NitoCp040 [Nicotiana tomen... 64 3e-10 ref|YP_358686.1| hypothetical protein NisyCp041 [Nicotiana sylve... 61 3e-09 >ref|YP_398873.1| hypothetical protein NitoCp040 [Nicotiana tomentosiformis] dbj|BAE48011.1| hypothetical protein (chloroplast) [Nicotiana tomentosiformis] Length = 71 Score = 63.5 bits (153), Expect = 3e-10 Identities = 33/50 (66%), Positives = 37/50 (74%), Gaps = 2/50 (4%) Frame = -2 Query: 461 YDNQLSYFSSFLCIFFLPSNLIK--KEFLTNYRKIR*NAIQPGFLVKMGF 318 YDN+L YFSSFLC+ FL SN +K KEFLT+YRKIR N Q FL KM F Sbjct: 2 YDNKLYYFSSFLCLLFLSSNFLKIDKEFLTDYRKIRSNPTQHEFLAKMVF 51 >ref|YP_358686.1| hypothetical protein NisyCp041 [Nicotiana sylvestris] ref|YP_004891614.1| unnamed protein product (chloroplast) [Nicotiana undulata] emb|CAJ32481.1| hypothetical protein (chloroplast) [Nicotiana tabacum] dbj|BAE46661.1| hypothetical protein (chloroplast) [Nicotiana sylvestris] gb|AEO95573.1| hypothetical protein (chloroplast) [Nicotiana undulata] gb|AEO95683.1| hypothetical protein [synthetic construct] Length = 71 Score = 60.8 bits (146), Expect = 3e-09 Identities = 32/50 (64%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -2 Query: 461 YDNQLSYFSSFLCIFFLPSNLIK--KEFLTNYRKIR*NAIQPGFLVKMGF 318 Y N+L YFSSFLC+ FL SN +K KEFLT+YRKIR N Q FL KM F Sbjct: 2 YHNKLYYFSSFLCLLFLSSNFLKIDKEFLTDYRKIRSNPTQHEFLAKMVF 51