BLASTX nr result
ID: Rehmannia29_contig00038422
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00038422 (512 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZV41768.1| hypothetical protein F511_22579 [Dorcoceras hygro... 59 1e-08 >gb|KZV41768.1| hypothetical protein F511_22579 [Dorcoceras hygrometricum] Length = 70 Score = 58.9 bits (141), Expect = 1e-08 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = -2 Query: 400 GTIRDQKFIPRSIKLMYGPHHGLNFLLKERSHHLVPHCINRSH 272 GTIRDQKFIP SIKL+YGPHHG F RSHHL+P + +H Sbjct: 24 GTIRDQKFIPTSIKLLYGPHHGSIF----RSHHLIPFPNSNNH 62