BLASTX nr result
ID: Rehmannia29_contig00037978
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00037978 (723 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011088882.1| VQ motif-containing protein 17-like [Sesamum... 72 3e-12 gb|PIN05878.1| hypothetical protein CDL12_21570 [Handroanthus im... 60 1e-07 gb|PIN25146.1| hypothetical protein CDL12_02088 [Handroanthus im... 55 7e-06 >ref|XP_011088882.1| VQ motif-containing protein 17-like [Sesamum indicum] Length = 157 Score = 72.4 bits (176), Expect = 3e-12 Identities = 34/47 (72%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = +1 Query: 1 EIYEAENTNAFLNFWGDVDGFFQDMNEFPLHSLR-SQINTYGEMSLC 138 +I + EN NAFL+FWGDVDGFF DMNEFPL S R SQ NT+GEM LC Sbjct: 111 DICDGENPNAFLSFWGDVDGFFLDMNEFPLLSFRPSQFNTFGEMPLC 157 >gb|PIN05878.1| hypothetical protein CDL12_21570 [Handroanthus impetiginosus] Length = 156 Score = 60.1 bits (144), Expect = 1e-07 Identities = 31/46 (67%), Positives = 35/46 (76%), Gaps = 1/46 (2%) Frame = +1 Query: 1 EIYEAENTNAFLNFWGDVDGFFQDMNEFPLHSLR-SQINTYGEMSL 135 EI + EN NAFL+F DVDGF DMNE PL S+R SQINT+GEM L Sbjct: 109 EIKQEENPNAFLSFLADVDGFLLDMNEIPLLSIRTSQINTFGEMPL 154 >gb|PIN25146.1| hypothetical protein CDL12_02088 [Handroanthus impetiginosus] Length = 156 Score = 55.1 bits (131), Expect = 7e-06 Identities = 29/46 (63%), Positives = 33/46 (71%), Gaps = 1/46 (2%) Frame = +1 Query: 1 EIYEAENTNAFLNFWGDVDGFFQDMNEFPLHSLR-SQINTYGEMSL 135 EI + EN NAFL+F DVDG DMNE PL S+R SQINT+ EM L Sbjct: 109 EIKQEENPNAFLSFLADVDGLLLDMNEIPLLSIRTSQINTFDEMPL 154