BLASTX nr result
ID: Rehmannia29_contig00037862
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00037862 (406 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011088317.2| pentatricopeptide repeat-containing protein ... 220 2e-65 gb|EYU37731.1| hypothetical protein MIMGU_mgv1a017991mg, partial... 206 2e-61 ref|XP_012836745.1| PREDICTED: pentatricopeptide repeat-containi... 206 2e-60 gb|PIN08677.1| hypothetical protein CDL12_18742 [Handroanthus im... 198 2e-57 ref|XP_015064305.1| PREDICTED: pentatricopeptide repeat-containi... 186 6e-53 ref|XP_010316500.1| PREDICTED: pentatricopeptide repeat-containi... 185 2e-52 ref|XP_015159630.1| PREDICTED: pentatricopeptide repeat-containi... 182 2e-51 ref|XP_019166015.1| PREDICTED: pentatricopeptide repeat-containi... 181 6e-51 ref|XP_016560314.1| PREDICTED: pentatricopeptide repeat-containi... 180 8e-51 emb|CDO97122.1| unnamed protein product [Coffea canephora] 180 1e-50 gb|PHU26639.1| hypothetical protein BC332_04971 [Capsicum chinense] 179 3e-50 gb|PHT90864.1| hypothetical protein T459_05977 [Capsicum annuum] 179 3e-50 gb|PHT56240.1| hypothetical protein CQW23_04726 [Capsicum baccatum] 179 3e-50 gb|OVA14957.1| Pentatricopeptide repeat [Macleaya cordata] 179 4e-50 ref|XP_002281535.1| PREDICTED: pentatricopeptide repeat-containi... 178 6e-50 ref|XP_022868842.1| putative pentatricopeptide repeat-containing... 174 3e-49 emb|CAN82371.1| hypothetical protein VITISV_027622 [Vitis vinifera] 176 4e-49 ref|XP_011624393.2| pentatricopeptide repeat-containing protein ... 167 2e-45 gb|PIA52392.1| hypothetical protein AQUCO_01000337v1 [Aquilegia ... 166 3e-45 ref|XP_010255213.1| PREDICTED: putative pentatricopeptide repeat... 165 6e-45 >ref|XP_011088317.2| pentatricopeptide repeat-containing protein At3g12770-like [Sesamum indicum] Length = 704 Score = 220 bits (560), Expect = 2e-65 Identities = 109/134 (81%), Positives = 120/134 (89%) Frame = +3 Query: 3 GNEAVELFLQMKRSGINPDESTFVSVLCACSHAGLVDLGLQIFDHITENRNIIPNSKHYA 182 GNEA+EL L+MK SG+NPD+STFVSVLCACSHAGLV GLQIFD +TE NIIP+ KHYA Sbjct: 414 GNEAIELLLKMKHSGLNPDDSTFVSVLCACSHAGLVAEGLQIFDRMTEVWNIIPSLKHYA 473 Query: 183 CVIDLLGRAGRLNEAYSLIKSINLLQPGPEVYSALLTACRVHKNFELGAEISRELFQLKP 362 CVIDLLGRAGRLNEAYSL+K ++ LQPG E+Y +LLTACR HKNFELG EISRELFQLKP Sbjct: 474 CVIDLLGRAGRLNEAYSLMKGMH-LQPGLEIYGSLLTACRTHKNFELGVEISRELFQLKP 532 Query: 363 NDAGYYVLLSNMYA 404 NDAGYYVLLSNMYA Sbjct: 533 NDAGYYVLLSNMYA 546 >gb|EYU37731.1| hypothetical protein MIMGU_mgv1a017991mg, partial [Erythranthe guttata] Length = 573 Score = 206 bits (525), Expect = 2e-61 Identities = 101/134 (75%), Positives = 120/134 (89%) Frame = +3 Query: 3 GNEAVELFLQMKRSGINPDESTFVSVLCACSHAGLVDLGLQIFDHITENRNIIPNSKHYA 182 GNEA+ELF QMK SG+ PDESTFVSVLC+CS+ GLVDLGLQIFD + + NIIP+SKHYA Sbjct: 283 GNEAIELFSQMKNSGLVPDESTFVSVLCSCSNTGLVDLGLQIFDRMQKLWNIIPSSKHYA 342 Query: 183 CVIDLLGRAGRLNEAYSLIKSINLLQPGPEVYSALLTACRVHKNFELGAEISRELFQLKP 362 CVIDLLGR+GR+NEAYSL+K ++ LQPG E+ S+LLTACR++KN E+G EISR+LF+LKP Sbjct: 343 CVIDLLGRSGRVNEAYSLMKRMH-LQPGVEILSSLLTACRIYKNLEVGIEISRKLFELKP 401 Query: 363 NDAGYYVLLSNMYA 404 NDAGYYVLLSNMYA Sbjct: 402 NDAGYYVLLSNMYA 415 >ref|XP_012836745.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Erythranthe guttata] Length = 684 Score = 206 bits (525), Expect = 2e-60 Identities = 101/134 (75%), Positives = 120/134 (89%) Frame = +3 Query: 3 GNEAVELFLQMKRSGINPDESTFVSVLCACSHAGLVDLGLQIFDHITENRNIIPNSKHYA 182 GNEA+ELF QMK SG+ PDESTFVSVLC+CS+ GLVDLGLQIFD + + NIIP+SKHYA Sbjct: 407 GNEAIELFSQMKNSGLVPDESTFVSVLCSCSNTGLVDLGLQIFDRMQKLWNIIPSSKHYA 466 Query: 183 CVIDLLGRAGRLNEAYSLIKSINLLQPGPEVYSALLTACRVHKNFELGAEISRELFQLKP 362 CVIDLLGR+GR+NEAYSL+K ++ LQPG E+ S+LLTACR++KN E+G EISR+LF+LKP Sbjct: 467 CVIDLLGRSGRVNEAYSLMKRMH-LQPGVEILSSLLTACRIYKNLEVGIEISRKLFELKP 525 Query: 363 NDAGYYVLLSNMYA 404 NDAGYYVLLSNMYA Sbjct: 526 NDAGYYVLLSNMYA 539 >gb|PIN08677.1| hypothetical protein CDL12_18742 [Handroanthus impetiginosus] Length = 705 Score = 198 bits (504), Expect = 2e-57 Identities = 97/134 (72%), Positives = 114/134 (85%) Frame = +3 Query: 3 GNEAVELFLQMKRSGINPDESTFVSVLCACSHAGLVDLGLQIFDHITENRNIIPNSKHYA 182 GNEA+ELF +M G++PDESTFVSVLCACSH GLV GLQIFDH+T+ NI P SKHY Sbjct: 415 GNEAIELFSKMTNLGVSPDESTFVSVLCACSHCGLVAQGLQIFDHMTKVWNIRPTSKHYT 474 Query: 183 CVIDLLGRAGRLNEAYSLIKSINLLQPGPEVYSALLTACRVHKNFELGAEISRELFQLKP 362 CVIDLLGRAGRL++AYSL+K ++ +PG EVYS+LL ACR+H+NFE G EISREL +LKP Sbjct: 475 CVIDLLGRAGRLHDAYSLMKRMH-PKPGVEVYSSLLNACRIHRNFERGVEISRELLELKP 533 Query: 363 NDAGYYVLLSNMYA 404 NDAGYYVLLSN+YA Sbjct: 534 NDAGYYVLLSNVYA 547 >ref|XP_015064305.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290, chloroplastic-like [Solanum pennellii] ref|XP_015064306.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290, chloroplastic-like [Solanum pennellii] Length = 707 Score = 186 bits (473), Expect = 6e-53 Identities = 88/134 (65%), Positives = 113/134 (84%) Frame = +3 Query: 3 GNEAVELFLQMKRSGINPDESTFVSVLCACSHAGLVDLGLQIFDHITENRNIIPNSKHYA 182 GN+A++LFL+MK G++P++ST VSVL ACSHAGLVD GL IFD++ N+ PN KHYA Sbjct: 417 GNDAIDLFLKMKDLGLDPNDSTLVSVLSACSHAGLVDQGLYIFDNMVARWNLNPNQKHYA 476 Query: 183 CVIDLLGRAGRLNEAYSLIKSINLLQPGPEVYSALLTACRVHKNFELGAEISRELFQLKP 362 CV+DLLGRAGRLN+AYS+IK+++ LQPG +VY ALL AC+ H N ELG E+S+ LF+LKP Sbjct: 477 CVVDLLGRAGRLNDAYSVIKNMH-LQPGVDVYGALLGACKAHGNIELGVEVSQRLFELKP 535 Query: 363 NDAGYYVLLSNMYA 404 +DAGYY+LLSN+YA Sbjct: 536 HDAGYYILLSNIYA 549 >ref|XP_010316500.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290, chloroplastic-like [Solanum lycopersicum] ref|XP_010316501.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290, chloroplastic-like [Solanum lycopersicum] ref|XP_010316502.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290, chloroplastic-like [Solanum lycopersicum] Length = 707 Score = 185 bits (469), Expect = 2e-52 Identities = 87/134 (64%), Positives = 112/134 (83%) Frame = +3 Query: 3 GNEAVELFLQMKRSGINPDESTFVSVLCACSHAGLVDLGLQIFDHITENRNIIPNSKHYA 182 GN+A++LFL+MK G++P++ST VSVL ACSH+GLVD GL IFD++ N+ PN KHYA Sbjct: 417 GNDAIDLFLKMKDLGLDPNDSTLVSVLSACSHSGLVDQGLYIFDNMVARWNLYPNQKHYA 476 Query: 183 CVIDLLGRAGRLNEAYSLIKSINLLQPGPEVYSALLTACRVHKNFELGAEISRELFQLKP 362 CV+DLLGRAGRLN+AYS+I S++ LQPG +VY ALL AC+ H N ELG E+S+ LF+LKP Sbjct: 477 CVVDLLGRAGRLNDAYSVITSMH-LQPGVDVYGALLGACKAHGNIELGVEVSQRLFELKP 535 Query: 363 NDAGYYVLLSNMYA 404 +DAGYY+LLSN+YA Sbjct: 536 HDAGYYILLSNIYA 549 >ref|XP_015159630.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290, chloroplastic-like [Solanum tuberosum] Length = 700 Score = 182 bits (462), Expect = 2e-51 Identities = 87/134 (64%), Positives = 112/134 (83%) Frame = +3 Query: 3 GNEAVELFLQMKRSGINPDESTFVSVLCACSHAGLVDLGLQIFDHITENRNIIPNSKHYA 182 GN+A++LFL+MK GI+P+EST VSVL AC HAGLVD GL IFD++ N+ PN KHYA Sbjct: 410 GNDAIDLFLKMKDLGIDPNESTLVSVLSACGHAGLVDQGLYIFDNMVARWNLYPNQKHYA 469 Query: 183 CVIDLLGRAGRLNEAYSLIKSINLLQPGPEVYSALLTACRVHKNFELGAEISRELFQLKP 362 CV+DLLGRAGRLN+AYS+I++++ LQPG +VY ALL A + H N ELG E+S++LF+LKP Sbjct: 470 CVVDLLGRAGRLNDAYSVIRNMH-LQPGVDVYGALLGASKAHGNIELGVEVSQKLFELKP 528 Query: 363 NDAGYYVLLSNMYA 404 +DAGYYVLLSN+Y+ Sbjct: 529 HDAGYYVLLSNIYS 542 >ref|XP_019166015.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290, chloroplastic-like [Ipomoea nil] Length = 704 Score = 181 bits (459), Expect = 6e-51 Identities = 84/134 (62%), Positives = 109/134 (81%) Frame = +3 Query: 3 GNEAVELFLQMKRSGINPDESTFVSVLCACSHAGLVDLGLQIFDHITENRNIIPNSKHYA 182 GN+A+ELF++M +G+ P++ST VSVLCACS AG+VD GL++F+ + E+ N++PN KHYA Sbjct: 414 GNDAIELFVKMGSAGVAPNDSTLVSVLCACSQAGMVDKGLEVFNSMVESWNVVPNQKHYA 473 Query: 183 CVIDLLGRAGRLNEAYSLIKSINLLQPGPEVYSALLTACRVHKNFELGAEISRELFQLKP 362 CV+ LLGRAGRLN+AYS++ I+ QPG EVY ALL AC+ H N ELG +IS LF+L P Sbjct: 474 CVVGLLGRAGRLNDAYSIVSEIH-SQPGVEVYGALLGACKAHGNIELGIKISERLFELNP 532 Query: 363 NDAGYYVLLSNMYA 404 +DAGYYVLLSNMYA Sbjct: 533 DDAGYYVLLSNMYA 546 >ref|XP_016560314.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290, chloroplastic-like [Capsicum annuum] Length = 668 Score = 180 bits (457), Expect = 8e-51 Identities = 87/134 (64%), Positives = 107/134 (79%) Frame = +3 Query: 3 GNEAVELFLQMKRSGINPDESTFVSVLCACSHAGLVDLGLQIFDHITENRNIIPNSKHYA 182 GN+AV LF +M+ GI+P+EST VSVL AC H GLV+ GL IFD++ N+ PN KHYA Sbjct: 416 GNDAVHLFQEMQDLGIDPNESTLVSVLSACGHGGLVEQGLYIFDNMVARWNLFPNQKHYA 475 Query: 183 CVIDLLGRAGRLNEAYSLIKSINLLQPGPEVYSALLTACRVHKNFELGAEISRELFQLKP 362 CV+DLLGRAGRLN+AYSLI +++ LQPG +VY ALL AC+ H N ELG E+S+ LF+LKP Sbjct: 476 CVVDLLGRAGRLNDAYSLISNMH-LQPGVDVYGALLGACKAHGNIELGVEVSQRLFELKP 534 Query: 363 NDAGYYVLLSNMYA 404 DAGYYVLLSN+YA Sbjct: 535 EDAGYYVLLSNIYA 548 >emb|CDO97122.1| unnamed protein product [Coffea canephora] Length = 707 Score = 180 bits (457), Expect = 1e-50 Identities = 86/134 (64%), Positives = 110/134 (82%) Frame = +3 Query: 3 GNEAVELFLQMKRSGINPDESTFVSVLCACSHAGLVDLGLQIFDHITENRNIIPNSKHYA 182 GN+A++LFL+MK SGINPDE T +S LCACSHAG+VD GL IF H+ E NI+PNSKHYA Sbjct: 417 GNDAIDLFLKMKGSGINPDEWTLLSALCACSHAGMVDQGLHIFHHMAEFWNIVPNSKHYA 476 Query: 183 CVIDLLGRAGRLNEAYSLIKSINLLQPGPEVYSALLTACRVHKNFELGAEISRELFQLKP 362 CVIDLLGRAG L++AY +I +++ L P +VY A+L+ACRVH+N E+G EI+R+L LKP Sbjct: 477 CVIDLLGRAGLLDDAYRMICNMH-LPPTVDVYCAMLSACRVHRNMEMGVEIARKLSALKP 535 Query: 363 NDAGYYVLLSNMYA 404 D G+++LLSNMYA Sbjct: 536 TDVGHHILLSNMYA 549 >gb|PHU26639.1| hypothetical protein BC332_04971 [Capsicum chinense] Length = 706 Score = 179 bits (454), Expect = 3e-50 Identities = 86/134 (64%), Positives = 107/134 (79%) Frame = +3 Query: 3 GNEAVELFLQMKRSGINPDESTFVSVLCACSHAGLVDLGLQIFDHITENRNIIPNSKHYA 182 GN+AV LF +M+ GI+P+EST VSVL AC H GLV+ GL IFD++ N+ PN KHYA Sbjct: 416 GNDAVHLFQEMQDLGIDPNESTLVSVLSACGHGGLVEQGLYIFDNMVATWNLFPNQKHYA 475 Query: 183 CVIDLLGRAGRLNEAYSLIKSINLLQPGPEVYSALLTACRVHKNFELGAEISRELFQLKP 362 CV+DLLGRAGRLN+AYS+I +++ LQPG +VY ALL AC+ H N ELG E+S+ LF+LKP Sbjct: 476 CVVDLLGRAGRLNDAYSVISNMH-LQPGVDVYGALLGACKAHGNIELGVEVSQRLFELKP 534 Query: 363 NDAGYYVLLSNMYA 404 DAGYYVLLSN+YA Sbjct: 535 EDAGYYVLLSNIYA 548 >gb|PHT90864.1| hypothetical protein T459_05977 [Capsicum annuum] Length = 706 Score = 179 bits (454), Expect = 3e-50 Identities = 86/134 (64%), Positives = 107/134 (79%) Frame = +3 Query: 3 GNEAVELFLQMKRSGINPDESTFVSVLCACSHAGLVDLGLQIFDHITENRNIIPNSKHYA 182 GN+AV LF +M+ GI+P+EST VSVL AC H GLV+ GL IFD++ N+ PN KHYA Sbjct: 416 GNDAVHLFQEMQDLGIDPNESTLVSVLSACGHGGLVEQGLYIFDNMVARWNLFPNQKHYA 475 Query: 183 CVIDLLGRAGRLNEAYSLIKSINLLQPGPEVYSALLTACRVHKNFELGAEISRELFQLKP 362 CV+DLLGRAGRLN+AYS+I +++ LQPG +VY ALL AC+ H N ELG E+S+ LF+LKP Sbjct: 476 CVVDLLGRAGRLNDAYSVISNMH-LQPGVDVYGALLGACKAHGNIELGVEVSQRLFELKP 534 Query: 363 NDAGYYVLLSNMYA 404 DAGYYVLLSN+YA Sbjct: 535 EDAGYYVLLSNIYA 548 >gb|PHT56240.1| hypothetical protein CQW23_04726 [Capsicum baccatum] Length = 706 Score = 179 bits (454), Expect = 3e-50 Identities = 86/134 (64%), Positives = 107/134 (79%) Frame = +3 Query: 3 GNEAVELFLQMKRSGINPDESTFVSVLCACSHAGLVDLGLQIFDHITENRNIIPNSKHYA 182 GN+AV LF +M+ GI+P+EST VSVL AC H GLV+ GL IFD++ N+ PN KHYA Sbjct: 416 GNDAVHLFQEMQDLGIDPNESTLVSVLSACGHGGLVEQGLYIFDNMVARWNLFPNQKHYA 475 Query: 183 CVIDLLGRAGRLNEAYSLIKSINLLQPGPEVYSALLTACRVHKNFELGAEISRELFQLKP 362 CV+DLLGRAGRLN+AYS+I +++ LQPG +VY ALL AC+ H N ELG E+S+ LF+LKP Sbjct: 476 CVVDLLGRAGRLNDAYSVISNMH-LQPGVDVYGALLGACKAHGNIELGVEVSQRLFELKP 534 Query: 363 NDAGYYVLLSNMYA 404 DAGYYVLLSN+YA Sbjct: 535 EDAGYYVLLSNIYA 548 >gb|OVA14957.1| Pentatricopeptide repeat [Macleaya cordata] Length = 727 Score = 179 bits (454), Expect = 4e-50 Identities = 87/134 (64%), Positives = 112/134 (83%) Frame = +3 Query: 3 GNEAVELFLQMKRSGINPDESTFVSVLCACSHAGLVDLGLQIFDHITENRNIIPNSKHYA 182 G++AV+LFL+MK SGI P+ STFV VLCACSHAG+VD GLQIFD + + NI+PN +HY+ Sbjct: 437 GDDAVDLFLRMKGSGIEPNNSTFVCVLCACSHAGMVDKGLQIFDLMFKKWNIVPNLQHYS 496 Query: 183 CVIDLLGRAGRLNEAYSLIKSINLLQPGPEVYSALLTACRVHKNFELGAEISRELFQLKP 362 C++DLLGRAG+L++AYSLI ++ L+P VY ALL AC VH+N +LG EIS++LFQL+ Sbjct: 497 CIVDLLGRAGQLDDAYSLINNMP-LKPDAGVYGALLAACNVHRNIKLGLEISQKLFQLEL 555 Query: 363 NDAGYYVLLSNMYA 404 NDAGYYVLLSNM+A Sbjct: 556 NDAGYYVLLSNMHA 569 >ref|XP_002281535.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic [Vitis vinifera] ref|XP_010647803.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic [Vitis vinifera] ref|XP_010647804.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic [Vitis vinifera] ref|XP_010647805.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic [Vitis vinifera] ref|XP_010647806.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic [Vitis vinifera] ref|XP_010647807.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic [Vitis vinifera] ref|XP_010647808.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic [Vitis vinifera] ref|XP_010647810.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic [Vitis vinifera] ref|XP_019073652.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic [Vitis vinifera] ref|XP_019073654.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic [Vitis vinifera] ref|XP_019073664.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic [Vitis vinifera] emb|CBI32501.3| unnamed protein product, partial [Vitis vinifera] Length = 697 Score = 178 bits (452), Expect = 6e-50 Identities = 86/134 (64%), Positives = 111/134 (82%) Frame = +3 Query: 3 GNEAVELFLQMKRSGINPDESTFVSVLCACSHAGLVDLGLQIFDHITENRNIIPNSKHYA 182 G +A++LFLQMK SG++PDESTFVSVL ACSHAG+V GLQIF H+ + ++IPN +HYA Sbjct: 407 GTDAIDLFLQMKGSGLDPDESTFVSVLYACSHAGMVYEGLQIFYHMVKTSHVIPNLQHYA 466 Query: 183 CVIDLLGRAGRLNEAYSLIKSINLLQPGPEVYSALLTACRVHKNFELGAEISRELFQLKP 362 CVID+LGRAG+L+ AYS I ++ QP +VYS LL ACR+H N +LG EIS+++F+++P Sbjct: 467 CVIDILGRAGQLDAAYSFINNMP-FQPDFDVYSTLLGACRIHGNIKLGHEISQKIFEMEP 525 Query: 363 NDAGYYVLLSNMYA 404 NDAGYYVLLSNMYA Sbjct: 526 NDAGYYVLLSNMYA 539 >ref|XP_022868842.1| putative pentatricopeptide repeat-containing protein At3g01580 [Olea europaea var. sylvestris] Length = 533 Score = 174 bits (441), Expect = 3e-49 Identities = 82/134 (61%), Positives = 111/134 (82%) Frame = +3 Query: 3 GNEAVELFLQMKRSGINPDESTFVSVLCACSHAGLVDLGLQIFDHITENRNIIPNSKHYA 182 GN A++LF+++K SG+ PD ST VS+LCACSHAGLVD GL+IF+ + N +I+P+ KHY Sbjct: 371 GNFAIDLFMKIKGSGLIPDGSTMVSILCACSHAGLVDQGLEIFNQMVANWSIVPSLKHYV 430 Query: 183 CVIDLLGRAGRLNEAYSLIKSINLLQPGPEVYSALLTACRVHKNFELGAEISRELFQLKP 362 CVIDLL RAGRL++AY+L+K +++ P++YSALL+AC+VHKN E+G +ISR+LF+ +P Sbjct: 431 CVIDLLARAGRLDDAYALMKRMDV---HPDIYSALLSACQVHKNVEMGIKISRKLFESRP 487 Query: 363 NDAGYYVLLSNMYA 404 ND G YVLLSNMYA Sbjct: 488 NDVGQYVLLSNMYA 501 >emb|CAN82371.1| hypothetical protein VITISV_027622 [Vitis vinifera] Length = 697 Score = 176 bits (446), Expect = 4e-49 Identities = 86/134 (64%), Positives = 110/134 (82%) Frame = +3 Query: 3 GNEAVELFLQMKRSGINPDESTFVSVLCACSHAGLVDLGLQIFDHITENRNIIPNSKHYA 182 G +A++LFLQMK SG++PDESTFVSVL ACSHAG+V GLQIF H+ + + IPN +HYA Sbjct: 407 GTDAIDLFLQMKGSGLDPDESTFVSVLYACSHAGMVYEGLQIFYHMVKTSHDIPNLQHYA 466 Query: 183 CVIDLLGRAGRLNEAYSLIKSINLLQPGPEVYSALLTACRVHKNFELGAEISRELFQLKP 362 CVID+LGRAG+L+ AYS I ++ QP +VYS LL ACR+H N +LG EIS+++F+++P Sbjct: 467 CVIDILGRAGQLDAAYSFINNMP-FQPDFDVYSTLLGACRIHGNIKLGHEISQKIFEMEP 525 Query: 363 NDAGYYVLLSNMYA 404 NDAGYYVLLSNMYA Sbjct: 526 NDAGYYVLLSNMYA 539 >ref|XP_011624393.2| pentatricopeptide repeat-containing protein At3g12770-like [Amborella trichopoda] Length = 759 Score = 167 bits (422), Expect = 2e-45 Identities = 80/134 (59%), Positives = 104/134 (77%) Frame = +3 Query: 3 GNEAVELFLQMKRSGINPDESTFVSVLCACSHAGLVDLGLQIFDHITENRNIIPNSKHYA 182 G++A++L QM+ + P+EST V VLCACSHAGLVD GLQIF+ + +++PNS+HYA Sbjct: 469 GDDAIDLLTQMEHVDLRPNESTLVCVLCACSHAGLVDHGLQIFNRLIRQFSMVPNSQHYA 528 Query: 183 CVIDLLGRAGRLNEAYSLIKSINLLQPGPEVYSALLTACRVHKNFELGAEISRELFQLKP 362 CVIDLLGRAGRL+EAYS IK++ + P + ALL ACR+H+N LG +++ELF+L P Sbjct: 529 CVIDLLGRAGRLDEAYSFIKNMP-MAPDAGILGALLGACRLHRNIGLGVLVAKELFELNP 587 Query: 363 NDAGYYVLLSNMYA 404 DAGYYVLLSNMYA Sbjct: 588 KDAGYYVLLSNMYA 601 >gb|PIA52392.1| hypothetical protein AQUCO_01000337v1 [Aquilegia coerulea] Length = 707 Score = 166 bits (419), Expect = 3e-45 Identities = 79/134 (58%), Positives = 104/134 (77%) Frame = +3 Query: 3 GNEAVELFLQMKRSGINPDESTFVSVLCACSHAGLVDLGLQIFDHITENRNIIPNSKHYA 182 G +AV+LF QMK I PDEST V VLCACSHAG+VD G +F+H+ E NI+PN +HYA Sbjct: 417 GCDAVDLFSQMKGLDITPDESTLVCVLCACSHAGMVDQGSSLFNHMDEEWNIVPNLQHYA 476 Query: 183 CVIDLLGRAGRLNEAYSLIKSINLLQPGPEVYSALLTACRVHKNFELGAEISRELFQLKP 362 C++DLLGR GRL++A +LI+ + LQP VY ALL+AC++H+N ELG +++L +L P Sbjct: 477 CMVDLLGRVGRLDDANTLIRDMP-LQPDAAVYGALLSACKIHRNIELGLAAAQKLLELDP 535 Query: 363 NDAGYYVLLSNMYA 404 +DAG+YVLLSNMYA Sbjct: 536 DDAGFYVLLSNMYA 549 >ref|XP_010255213.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460 [Nelumbo nucifera] Length = 725 Score = 165 bits (417), Expect = 6e-45 Identities = 79/134 (58%), Positives = 104/134 (77%) Frame = +3 Query: 3 GNEAVELFLQMKRSGINPDESTFVSVLCACSHAGLVDLGLQIFDHITENRNIIPNSKHYA 182 G++A++L +M+ G+ PDEST + VLCACSHAG+VD GL IF + +I+PN +HY Sbjct: 435 GDDAIDLLWKMQGKGLEPDESTLLCVLCACSHAGMVDQGLHIFHCMVRYWHILPNLQHYT 494 Query: 183 CVIDLLGRAGRLNEAYSLIKSINLLQPGPEVYSALLTACRVHKNFELGAEISRELFQLKP 362 C++DLLGRAGRL++A+ LI ++ LQP VY ALL ACRVH N +LG +IS++LF+L P Sbjct: 495 CIVDLLGRAGRLDDAHLLINTMP-LQPDAGVYGALLGACRVHGNIDLGLQISKKLFELDP 553 Query: 363 NDAGYYVLLSNMYA 404 NDAGYYVLLSNMYA Sbjct: 554 NDAGYYVLLSNMYA 567