BLASTX nr result
ID: Rehmannia29_contig00037767
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00037767 (585 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011070188.1| aspartic proteinase nepenthesin-2-like [Sesa... 65 9e-09 gb|EYU30351.1| hypothetical protein MIMGU_mgv1a007310mg [Erythra... 60 3e-07 ref|XP_012845842.1| PREDICTED: aspartic proteinase nepenthesin-1... 60 4e-07 >ref|XP_011070188.1| aspartic proteinase nepenthesin-2-like [Sesamum indicum] Length = 430 Score = 64.7 bits (156), Expect = 9e-09 Identities = 34/73 (46%), Positives = 42/73 (57%), Gaps = 1/73 (1%) Frame = +2 Query: 368 YMDTGSNLVCINCEPNGYNVPEPIFHPTEPSS*ELWKIVNTFIFVMLPDAVKVWCD-DDG 544 YMDTGS+L+ INCEP G NVP P++HP E SS F V+ CD D+ Sbjct: 93 YMDTGSSLLWINCEPCGLNVPAPLYHPQESSSYRKQYCDQDFDICESTGTVRTECDIDNI 152 Query: 545 CTYNVQYGGGGYS 583 C Y+V+YG YS Sbjct: 153 CLYHVRYGSEDYS 165 >gb|EYU30351.1| hypothetical protein MIMGU_mgv1a007310mg [Erythranthe guttata] Length = 411 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/68 (45%), Positives = 43/68 (63%), Gaps = 1/68 (1%) Frame = +2 Query: 368 YMDTGSNLVCINCEPNGYNVPEPIFHPTEPSS*ELWKIVNTFIFVML-PDAVKVWCDDDG 544 YMDT S+L INCEP G NV P+FHP E S+ E+ + N + ++ + AV + CD Sbjct: 61 YMDTASSLFWINCEPCGLNVLGPLFHPKESSTYEV-EDCNDYDYICIGTGAVNIECDSVK 119 Query: 545 CTYNVQYG 568 CT+ +QYG Sbjct: 120 CTFAIQYG 127 >ref|XP_012845842.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Erythranthe guttata] Length = 460 Score = 60.1 bits (144), Expect = 4e-07 Identities = 31/68 (45%), Positives = 43/68 (63%), Gaps = 1/68 (1%) Frame = +2 Query: 368 YMDTGSNLVCINCEPNGYNVPEPIFHPTEPSS*ELWKIVNTFIFVML-PDAVKVWCDDDG 544 YMDT S+L INCEP G NV P+FHP E S+ E+ + N + ++ + AV + CD Sbjct: 110 YMDTASSLFWINCEPCGLNVLGPLFHPKESSTYEV-EDCNDYDYICIGTGAVNIECDSVK 168 Query: 545 CTYNVQYG 568 CT+ +QYG Sbjct: 169 CTFAIQYG 176