BLASTX nr result
ID: Rehmannia29_contig00037253
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00037253 (433 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011071956.1| pentatricopeptide repeat-containing protein ... 85 2e-16 gb|PIN26370.1| hypothetical protein CDL12_00882 [Handroanthus im... 82 2e-15 ref|XP_019185024.1| PREDICTED: pentatricopeptide repeat-containi... 81 5e-15 ref|XP_022857776.1| pentatricopeptide repeat-containing protein ... 80 1e-14 gb|PHT88008.1| Pentatricopeptide repeat-containing protein, chlo... 80 1e-14 gb|PHT53943.1| Pentatricopeptide repeat-containing protein, chlo... 80 1e-14 ref|XP_016563700.1| PREDICTED: pentatricopeptide repeat-containi... 80 1e-14 gb|PHU23799.1| hypothetical protein BC332_08906 [Capsicum chinense] 80 1e-14 gb|EYU22186.1| hypothetical protein MIMGU_mgv1a005737mg [Erythra... 80 1e-14 ref|XP_012855660.1| PREDICTED: pentatricopeptide repeat-containi... 80 2e-14 ref|XP_015067761.1| PREDICTED: pentatricopeptide repeat-containi... 80 2e-14 ref|XP_006344474.1| PREDICTED: pentatricopeptide repeat-containi... 80 2e-14 ref|XP_019243615.1| PREDICTED: pentatricopeptide repeat-containi... 78 5e-14 ref|XP_016494923.1| PREDICTED: pentatricopeptide repeat-containi... 78 5e-14 ref|XP_009782591.1| PREDICTED: pentatricopeptide repeat-containi... 78 5e-14 ref|XP_009587009.1| PREDICTED: pentatricopeptide repeat-containi... 78 5e-14 ref|XP_021675833.1| pentatricopeptide repeat-containing protein ... 78 7e-14 ref|XP_002277390.1| PREDICTED: pentatricopeptide repeat-containi... 78 7e-14 ref|XP_004236267.1| PREDICTED: pentatricopeptide repeat-containi... 77 1e-13 ref|XP_021616821.1| pentatricopeptide repeat-containing protein ... 77 1e-13 >ref|XP_011071956.1| pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Sesamum indicum] Length = 625 Score = 85.1 bits (209), Expect = 2e-16 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +1 Query: 1 HVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGSAM 120 HV KSFFDEGRHSEAKDLL+KCPHHIRKHPA+CSLFGSA+ Sbjct: 586 HVLKSFFDEGRHSEAKDLLFKCPHHIRKHPAICSLFGSAI 625 >gb|PIN26370.1| hypothetical protein CDL12_00882 [Handroanthus impetiginosus] Length = 625 Score = 82.0 bits (201), Expect = 2e-15 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = +1 Query: 1 HVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGSAM 120 HVFKSFFDEGR+SEAKDLL+KCPHHIRKH A+CSLFGSA+ Sbjct: 586 HVFKSFFDEGRYSEAKDLLFKCPHHIRKHSAICSLFGSAV 625 >ref|XP_019185024.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Ipomoea nil] Length = 633 Score = 81.3 bits (199), Expect = 5e-15 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +1 Query: 1 HVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGSA 117 HV +SFF+EGRHSEAKDLLYKCPHHIRKHP +CSLFGSA Sbjct: 591 HVLESFFEEGRHSEAKDLLYKCPHHIRKHPKICSLFGSA 629 >ref|XP_022857776.1| pentatricopeptide repeat-containing protein At3g48250, chloroplastic, partial [Olea europaea var. sylvestris] Length = 538 Score = 80.1 bits (196), Expect = 1e-14 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = +1 Query: 1 HVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGSA 117 H+F+SFF+EGR SEAKDLLYKCPHH+RKHP VCSLFGSA Sbjct: 499 HIFESFFNEGRQSEAKDLLYKCPHHVRKHPVVCSLFGSA 537 >gb|PHT88008.1| Pentatricopeptide repeat-containing protein, chloroplastic [Capsicum annuum] Length = 649 Score = 80.1 bits (196), Expect = 1e-14 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = +1 Query: 1 HVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGSA 117 HVF+SFF EGRHSEAKDLLYKCPHHIR+HPA+C LFGS+ Sbjct: 593 HVFRSFFAEGRHSEAKDLLYKCPHHIRQHPAICGLFGSS 631 >gb|PHT53943.1| Pentatricopeptide repeat-containing protein, chloroplastic [Capsicum baccatum] Length = 649 Score = 80.1 bits (196), Expect = 1e-14 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = +1 Query: 1 HVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGSA 117 HVF+SFF EGRHSEAKDLLYKCPHHIR+HPA+C LFGS+ Sbjct: 593 HVFRSFFAEGRHSEAKDLLYKCPHHIRQHPAICGLFGSS 631 >ref|XP_016563700.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Capsicum annuum] ref|XP_016563701.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Capsicum annuum] ref|XP_016563702.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Capsicum annuum] ref|XP_016563703.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Capsicum annuum] ref|XP_016563704.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Capsicum annuum] Length = 649 Score = 80.1 bits (196), Expect = 1e-14 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = +1 Query: 1 HVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGSA 117 HVF+SFF EGRHSEAKDLLYKCPHHIR+HPA+C LFGS+ Sbjct: 593 HVFRSFFAEGRHSEAKDLLYKCPHHIRQHPAICGLFGSS 631 >gb|PHU23799.1| hypothetical protein BC332_08906 [Capsicum chinense] Length = 743 Score = 80.1 bits (196), Expect = 1e-14 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = +1 Query: 1 HVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGSA 117 HVF+SFF EGRHSEAKDLLYKCPHHIR+HPA+C LFGS+ Sbjct: 561 HVFRSFFAEGRHSEAKDLLYKCPHHIRQHPAICGLFGSS 599 >gb|EYU22186.1| hypothetical protein MIMGU_mgv1a005737mg [Erythranthe guttata] Length = 472 Score = 79.7 bits (195), Expect = 1e-14 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +1 Query: 1 HVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGSA 117 HVFKSFFDE RHSEAKDLL+KCPHHIRKHPA+ +LFGSA Sbjct: 433 HVFKSFFDESRHSEAKDLLFKCPHHIRKHPAISALFGSA 471 >ref|XP_012855660.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Erythranthe guttata] Length = 623 Score = 79.7 bits (195), Expect = 2e-14 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +1 Query: 1 HVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGSA 117 HVFKSFFDE RHSEAKDLL+KCPHHIRKHPA+ +LFGSA Sbjct: 584 HVFKSFFDESRHSEAKDLLFKCPHHIRKHPAISALFGSA 622 >ref|XP_015067761.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Solanum pennellii] Length = 642 Score = 79.7 bits (195), Expect = 2e-14 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = +1 Query: 1 HVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGSA 117 HVF+SFF EGRHSEAKDLLYKCPHHIR+HPA+C LFGS+ Sbjct: 586 HVFQSFFAEGRHSEAKDLLYKCPHHIRQHPAICGLFGSS 624 >ref|XP_006344474.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Solanum tuberosum] Length = 642 Score = 79.7 bits (195), Expect = 2e-14 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = +1 Query: 1 HVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGSA 117 HVF+SFF EGRHSEAKDLLYKCPHHIR+HPA+C LFGS+ Sbjct: 586 HVFQSFFAEGRHSEAKDLLYKCPHHIRQHPAICGLFGSS 624 >ref|XP_019243615.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Nicotiana attenuata] ref|XP_019243616.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Nicotiana attenuata] gb|OIT04845.1| pentatricopeptide repeat-containing protein, chloroplastic [Nicotiana attenuata] Length = 642 Score = 78.2 bits (191), Expect = 5e-14 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +1 Query: 1 HVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGS 114 HVF++FF EGRHSEAKDLLYKCPHHIR+HPA+C LFGS Sbjct: 586 HVFQTFFAEGRHSEAKDLLYKCPHHIRQHPAICGLFGS 623 >ref|XP_016494923.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Nicotiana tabacum] Length = 642 Score = 78.2 bits (191), Expect = 5e-14 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +1 Query: 1 HVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGS 114 HVF++FF EGRHSEAKDLLYKCPHHIR+HPA+C LFGS Sbjct: 586 HVFQTFFAEGRHSEAKDLLYKCPHHIRQHPAICGLFGS 623 >ref|XP_009782591.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Nicotiana sylvestris] Length = 642 Score = 78.2 bits (191), Expect = 5e-14 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +1 Query: 1 HVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGS 114 HVF++FF EGRHSEAKDLLYKCPHHIR+HPA+C LFGS Sbjct: 586 HVFQTFFAEGRHSEAKDLLYKCPHHIRQHPAICGLFGS 623 >ref|XP_009587009.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Nicotiana tomentosiformis] ref|XP_016447862.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Nicotiana tabacum] Length = 642 Score = 78.2 bits (191), Expect = 5e-14 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +1 Query: 1 HVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGS 114 HVF++FF EGRHSEAKDLLYKCPHHIR+HPA+C LFGS Sbjct: 586 HVFQTFFAEGRHSEAKDLLYKCPHHIRQHPAICGLFGS 623 >ref|XP_021675833.1| pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Hevea brasiliensis] Length = 629 Score = 77.8 bits (190), Expect = 7e-14 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +1 Query: 1 HVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGSA 117 HVF+SFF EGRHSEAKDLLYKCPH IRKHP +C LFGSA Sbjct: 584 HVFQSFFKEGRHSEAKDLLYKCPHRIRKHPKICELFGSA 622 >ref|XP_002277390.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Vitis vinifera] Length = 631 Score = 77.8 bits (190), Expect = 7e-14 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +1 Query: 1 HVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGSA 117 HVF+SFF EGR SEAKDLLYKCPHHIRKHP +C LFGSA Sbjct: 584 HVFESFFQEGRESEAKDLLYKCPHHIRKHPDICKLFGSA 622 >ref|XP_004236267.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Solanum lycopersicum] ref|XP_010319018.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Solanum lycopersicum] ref|XP_010319019.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Solanum lycopersicum] Length = 642 Score = 77.4 bits (189), Expect = 1e-13 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = +1 Query: 1 HVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGSA 117 HVF+SFF EGRHSEAKDLLYKCP+HIR+HPA+C LFGS+ Sbjct: 586 HVFQSFFAEGRHSEAKDLLYKCPYHIRQHPAICGLFGSS 624 >ref|XP_021616821.1| pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Manihot esculenta] gb|OAY47851.1| hypothetical protein MANES_06G110600 [Manihot esculenta] Length = 621 Score = 77.0 bits (188), Expect = 1e-13 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +1 Query: 1 HVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGSA 117 HVF+SFF EGRHSEAKDLLYKCPHHIRKHP + LFGSA Sbjct: 580 HVFQSFFKEGRHSEAKDLLYKCPHHIRKHPKISELFGSA 618