BLASTX nr result
ID: Rehmannia29_contig00037177
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00037177 (521 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011074454.1| probable carboxylesterase 2 [Sesamum indicum] 55 7e-06 >ref|XP_011074454.1| probable carboxylesterase 2 [Sesamum indicum] Length = 323 Score = 55.5 bits (132), Expect = 7e-06 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 2/50 (4%) Frame = +3 Query: 378 METIKSKLYLAEDVPPFVKVY--GYVDRLQGTDTVPAAYDPETGVTSKDV 521 MET SK L DVPP+++VY G V+RL GT+T P A DP+TGV+SKDV Sbjct: 1 METTYSKPVL-HDVPPYIRVYEDGTVERLVGTETAPPALDPKTGVSSKDV 49