BLASTX nr result
ID: Rehmannia29_contig00037115
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00037115 (445 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009381207.1| hypothetical protein AEK19_MT0809 (mitochond... 96 3e-23 >ref|YP_009381207.1| hypothetical protein AEK19_MT0809 (mitochondrion) [Utricularia reniformis] gb|ART31046.1| hypothetical protein AEK19_MT0809 (mitochondrion) [Utricularia reniformis] Length = 71 Score = 95.9 bits (237), Expect = 3e-23 Identities = 46/58 (79%), Positives = 50/58 (86%) Frame = +1 Query: 247 NRPYSSYE*PSQIYTHHSNVFFVITWLENRINMNLKRTHLRRMPIQLNFSLVGLDRKG 420 +R Y E PSQIYTHHSNVFFV +WLEN INMN +RTHLRRMPIQLNFSL+GLDRKG Sbjct: 14 DRCYGIAELPSQIYTHHSNVFFVSSWLENCINMNQQRTHLRRMPIQLNFSLLGLDRKG 71