BLASTX nr result
ID: Rehmannia29_contig00037049
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00037049 (716 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011090370.1| pentatricopeptide repeat-containing protein ... 168 2e-44 gb|PIN17701.1| hypothetical protein CDL12_09632 [Handroanthus im... 162 1e-42 ref|XP_012850802.1| PREDICTED: pentatricopeptide repeat-containi... 162 2e-42 ref|XP_022853143.1| pentatricopeptide repeat-containing protein ... 154 3e-41 gb|EYU26180.1| hypothetical protein MIMGU_mgv1a024509mg, partial... 151 1e-38 ref|XP_019053332.1| PREDICTED: pentatricopeptide repeat-containi... 145 2e-36 ref|XP_010257292.1| PREDICTED: pentatricopeptide repeat-containi... 145 2e-36 emb|CAN78822.1| hypothetical protein VITISV_006669 [Vitis vinifera] 143 1e-35 ref|XP_023531862.1| pentatricopeptide repeat-containing protein ... 142 3e-35 ref|XP_007014996.2| PREDICTED: pentatricopeptide repeat-containi... 140 3e-34 ref|XP_022966942.1| pentatricopeptide repeat-containing protein ... 139 3e-34 ref|XP_022927674.1| pentatricopeptide repeat-containing protein ... 139 3e-34 emb|CDP20154.1| unnamed protein product [Coffea canephora] 139 4e-34 ref|XP_023898683.1| pentatricopeptide repeat-containing protein ... 138 7e-34 ref|XP_022154126.1| pentatricopeptide repeat-containing protein ... 138 1e-33 gb|OMO78085.1| hypothetical protein COLO4_24857 [Corchorus olito... 136 1e-33 gb|EOY32615.1| Slow growth 1, putative [Theobroma cacao] 137 1e-33 ref|XP_022754258.1| pentatricopeptide repeat-containing protein ... 137 2e-33 ref|XP_022754257.1| pentatricopeptide repeat-containing protein ... 137 2e-33 ref|XP_021277920.1| LOW QUALITY PROTEIN: pentatricopeptide repea... 137 2e-33 >ref|XP_011090370.1| pentatricopeptide repeat-containing protein At2g22410, mitochondrial [Sesamum indicum] Length = 701 Score = 168 bits (425), Expect = 2e-44 Identities = 84/107 (78%), Positives = 90/107 (84%), Gaps = 9/107 (8%) Frame = -2 Query: 715 KLLELDPDDSGIYVLLANMYVERNMWQKAGEVRKMMRERGVDKTPGCSSIEVNGNVYEFI 536 KLL+LDP DSGIYVLLANMYVE NMW KAGEVRKMMRERGVDKTPGCSSIEVNGN+YEFI Sbjct: 595 KLLDLDPSDSGIYVLLANMYVEANMWDKAGEVRKMMRERGVDKTPGCSSIEVNGNLYEFI 654 Query: 535 VRDKSHSQTGHIYECLVQLSKQMELLE---------DEFLFGSEVGS 422 VRDKSH Q+ IYECL+QLSKQMEL+E DEFLF SEV + Sbjct: 655 VRDKSHPQSNQIYECLIQLSKQMELVESVAGVPHPKDEFLFASEVNN 701 >gb|PIN17701.1| hypothetical protein CDL12_09632 [Handroanthus impetiginosus] Length = 690 Score = 162 bits (411), Expect = 1e-42 Identities = 82/107 (76%), Positives = 89/107 (83%), Gaps = 9/107 (8%) Frame = -2 Query: 715 KLLELDPDDSGIYVLLANMYVERNMWQKAGEVRKMMRERGVDKTPGCSSIEVNGNVYEFI 536 KLL+LDPDDSGIYVLLANMYVE NMW +AGEVRKMMRERGVDK PGCSSIEVNGN+YEFI Sbjct: 584 KLLQLDPDDSGIYVLLANMYVEANMWHEAGEVRKMMRERGVDKNPGCSSIEVNGNLYEFI 643 Query: 535 VRDKSHSQTGHIYECLVQLSKQMEL---------LEDEFLFGSEVGS 422 +RDKSH Q+ IYECL+QLSKQMEL L+DE LF S VGS Sbjct: 644 IRDKSHYQSNQIYECLMQLSKQMELEECVAGVSNLKDELLFCSAVGS 690 >ref|XP_012850802.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial [Erythranthe guttata] Length = 697 Score = 162 bits (411), Expect = 2e-42 Identities = 81/103 (78%), Positives = 91/103 (88%), Gaps = 6/103 (5%) Frame = -2 Query: 715 KLLELDPDDSGIYVLLANMYVERNMWQKAGEVRKMMRERGVDKTPGCSSIEVNGNVYEFI 536 +LLELDP DSGIYVLLANMYVERNMW+KAGEVRKMMRERGVDKTPGCSSIEV+GNVYEFI Sbjct: 594 RLLELDPSDSGIYVLLANMYVERNMWEKAGEVRKMMRERGVDKTPGCSSIEVDGNVYEFI 653 Query: 535 VRDKSHSQTGHIYECLVQLSKQMELLE------DEFLFGSEVG 425 VRDKSHS++ IYE LVQLS++M++ E D+FLF SEVG Sbjct: 654 VRDKSHSRSKEIYESLVQLSEEMKVFECVSDIKDDFLFASEVG 696 >ref|XP_022853143.1| pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Olea europaea var. sylvestris] Length = 384 Score = 154 bits (389), Expect = 3e-41 Identities = 76/102 (74%), Positives = 86/102 (84%), Gaps = 9/102 (8%) Frame = -2 Query: 715 KLLELDPDDSGIYVLLANMYVERNMWQKAGEVRKMMRERGVDKTPGCSSIEVNGNVYEFI 536 KLLELDP DSGIYVLLANMYVE NMW KAGEVRK+MRERGVDKTPGCSSIE+NGNVYEFI Sbjct: 283 KLLELDPGDSGIYVLLANMYVEANMWHKAGEVRKVMRERGVDKTPGCSSIELNGNVYEFI 342 Query: 535 VRDKSHSQTGHIYECLVQLSKQMELLE---------DEFLFG 437 VRD+SHSQ+ I+ CL+QL+KQM+L+E D+F FG Sbjct: 343 VRDQSHSQSNQIHACLIQLTKQMKLVESVAGICHLRDDFQFG 384 >gb|EYU26180.1| hypothetical protein MIMGU_mgv1a024509mg, partial [Erythranthe guttata] Length = 651 Score = 151 bits (382), Expect = 1e-38 Identities = 72/86 (83%), Positives = 82/86 (95%) Frame = -2 Query: 715 KLLELDPDDSGIYVLLANMYVERNMWQKAGEVRKMMRERGVDKTPGCSSIEVNGNVYEFI 536 +LLELDP DSGIYVLLANMYVERNMW+KAGEVRKMMRERGVDKTPGCSSIEV+GNVYEFI Sbjct: 547 RLLELDPSDSGIYVLLANMYVERNMWEKAGEVRKMMRERGVDKTPGCSSIEVDGNVYEFI 606 Query: 535 VRDKSHSQTGHIYECLVQLSKQMELL 458 VRDKSHS++ IYE LVQLS++M+++ Sbjct: 607 VRDKSHSRSKEIYESLVQLSEEMKVM 632 >ref|XP_019053332.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial isoform X2 [Nelumbo nucifera] Length = 672 Score = 145 bits (367), Expect = 2e-36 Identities = 70/93 (75%), Positives = 83/93 (89%) Frame = -2 Query: 715 KLLELDPDDSGIYVLLANMYVERNMWQKAGEVRKMMRERGVDKTPGCSSIEVNGNVYEFI 536 KLLELDP DSGIYVLLA+MYVE NMW+KAG+VR MMRERGV+KTPGCSSIEVNG VYEFI Sbjct: 533 KLLELDPHDSGIYVLLASMYVEANMWEKAGKVRVMMRERGVEKTPGCSSIEVNGIVYEFI 592 Query: 535 VRDKSHSQTGHIYECLVQLSKQMELLEDEFLFG 437 VRD+SH QT IYECL+QL++Q+E+ D+++ G Sbjct: 593 VRDRSHPQTQEIYECLIQLARQLEI--DDYVSG 623 >ref|XP_010257292.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial isoform X1 [Nelumbo nucifera] Length = 719 Score = 145 bits (367), Expect = 2e-36 Identities = 70/93 (75%), Positives = 83/93 (89%) Frame = -2 Query: 715 KLLELDPDDSGIYVLLANMYVERNMWQKAGEVRKMMRERGVDKTPGCSSIEVNGNVYEFI 536 KLLELDP DSGIYVLLA+MYVE NMW+KAG+VR MMRERGV+KTPGCSSIEVNG VYEFI Sbjct: 580 KLLELDPHDSGIYVLLASMYVEANMWEKAGKVRVMMRERGVEKTPGCSSIEVNGIVYEFI 639 Query: 535 VRDKSHSQTGHIYECLVQLSKQMELLEDEFLFG 437 VRD+SH QT IYECL+QL++Q+E+ D+++ G Sbjct: 640 VRDRSHPQTQEIYECLIQLARQLEI--DDYVSG 670 >emb|CAN78822.1| hypothetical protein VITISV_006669 [Vitis vinifera] Length = 599 Score = 143 bits (360), Expect = 1e-35 Identities = 70/106 (66%), Positives = 85/106 (80%), Gaps = 9/106 (8%) Frame = -2 Query: 715 KLLELDPDDSGIYVLLANMYVERNMWQKAGEVRKMMRERGVDKTPGCSSIEVNGNVYEFI 536 KLL++DP DSGIYVLLANMY E MW++AG+ RK+MR+RGV+KTPGCSSIEVNG VYEFI Sbjct: 491 KLLQMDPHDSGIYVLLANMYGEAEMWKEAGKXRKLMRQRGVEKTPGCSSIEVNGIVYEFI 550 Query: 535 VRDKSHSQTGHIYECLVQLSKQMELLE---------DEFLFGSEVG 425 VRDKSH Q+ IYECL+QL++Q+EL+E D LFGS+ G Sbjct: 551 VRDKSHPQSEQIYECLIQLTRQLELVECTPVFPIFGDNSLFGSDFG 596 >ref|XP_023531862.1| pentatricopeptide repeat-containing protein At2g22410, mitochondrial [Cucurbita pepo subsp. pepo] Length = 677 Score = 142 bits (358), Expect = 3e-35 Identities = 67/89 (75%), Positives = 78/89 (87%) Frame = -2 Query: 715 KLLELDPDDSGIYVLLANMYVERNMWQKAGEVRKMMRERGVDKTPGCSSIEVNGNVYEFI 536 KLLELDP DSGIYVLLANMY + NMW+KA +VRKMM ERGV+KTPGCSSIE+NG VYEFI Sbjct: 582 KLLELDPHDSGIYVLLANMYGDANMWEKARKVRKMMEERGVEKTPGCSSIEINGLVYEFI 641 Query: 535 VRDKSHSQTGHIYECLVQLSKQMELLEDE 449 +RDKSH Q+ IYECL L++Q+EL+EDE Sbjct: 642 IRDKSHPQSEKIYECLTWLTRQLELVEDE 670 >ref|XP_007014996.2| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial [Theobroma cacao] Length = 767 Score = 140 bits (352), Expect = 3e-34 Identities = 67/105 (63%), Positives = 84/105 (80%), Gaps = 9/105 (8%) Frame = -2 Query: 715 KLLELDPDDSGIYVLLANMYVERNMWQKAGEVRKMMRERGVDKTPGCSSIEVNGNVYEFI 536 KLLELDP DSGIYVLLANMY + NMW++AG+VRKMM+ERGV KTPGCSSIE+NG VYEFI Sbjct: 651 KLLELDPHDSGIYVLLANMYGDANMWEEAGKVRKMMKERGVGKTPGCSSIELNGTVYEFI 710 Query: 535 VRDKSHSQTGHIYECLVQLSKQMELLE---------DEFLFGSEV 428 VRDKSH +T IY+CL+QL++ ++ +E ++FL G E+ Sbjct: 711 VRDKSHPETQQIYDCLIQLTRHLDFVEFTYGLPKCYNDFLLGLEL 755 >ref|XP_022966942.1| pentatricopeptide repeat-containing protein At2g22410, mitochondrial [Cucurbita maxima] ref|XP_022966951.1| pentatricopeptide repeat-containing protein At2g22410, mitochondrial [Cucurbita maxima] ref|XP_022966960.1| pentatricopeptide repeat-containing protein At2g22410, mitochondrial [Cucurbita maxima] Length = 677 Score = 139 bits (351), Expect = 3e-34 Identities = 65/89 (73%), Positives = 78/89 (87%) Frame = -2 Query: 715 KLLELDPDDSGIYVLLANMYVERNMWQKAGEVRKMMRERGVDKTPGCSSIEVNGNVYEFI 536 KLLELDP DSGIYVLLANMY + NMW+KA +VRKMM ERGV+KTPGCSSIE+NG VYEFI Sbjct: 582 KLLELDPHDSGIYVLLANMYGDANMWEKARKVRKMMEERGVEKTPGCSSIEINGLVYEFI 641 Query: 535 VRDKSHSQTGHIYECLVQLSKQMELLEDE 449 +RDKSH ++ +YECL L++Q+EL+EDE Sbjct: 642 IRDKSHPRSEKMYECLTWLTRQLELVEDE 670 >ref|XP_022927674.1| pentatricopeptide repeat-containing protein At2g22410, mitochondrial [Cucurbita moschata] ref|XP_022927681.1| pentatricopeptide repeat-containing protein At2g22410, mitochondrial [Cucurbita moschata] ref|XP_022927688.1| pentatricopeptide repeat-containing protein At2g22410, mitochondrial [Cucurbita moschata] ref|XP_022927696.1| pentatricopeptide repeat-containing protein At2g22410, mitochondrial [Cucurbita moschata] ref|XP_022927700.1| pentatricopeptide repeat-containing protein At2g22410, mitochondrial [Cucurbita moschata] Length = 677 Score = 139 bits (351), Expect = 3e-34 Identities = 65/89 (73%), Positives = 78/89 (87%) Frame = -2 Query: 715 KLLELDPDDSGIYVLLANMYVERNMWQKAGEVRKMMRERGVDKTPGCSSIEVNGNVYEFI 536 KLLELDP DSGIYVLLANMY + NMW+KA +VRKMM +RGV+KTPGCSSIE+NG VYEFI Sbjct: 582 KLLELDPHDSGIYVLLANMYGDANMWEKARKVRKMMEQRGVEKTPGCSSIEINGLVYEFI 641 Query: 535 VRDKSHSQTGHIYECLVQLSKQMELLEDE 449 +RDKSH ++ IYECL L++Q+EL+EDE Sbjct: 642 IRDKSHPRSEKIYECLTWLTRQLELVEDE 670 >emb|CDP20154.1| unnamed protein product [Coffea canephora] Length = 696 Score = 139 bits (350), Expect = 4e-34 Identities = 64/87 (73%), Positives = 77/87 (88%) Frame = -2 Query: 715 KLLELDPDDSGIYVLLANMYVERNMWQKAGEVRKMMRERGVDKTPGCSSIEVNGNVYEFI 536 KLLELDP DSGIYVLLA+MY+E NMW K+ EVRKMM+ERGVDKTPGCSSIEV G+V+EF+ Sbjct: 590 KLLELDPQDSGIYVLLASMYIEANMWHKSREVRKMMKERGVDKTPGCSSIEVKGDVWEFM 649 Query: 535 VRDKSHSQTGHIYECLVQLSKQMELLE 455 V+DKSH Q IY+CL++L +QMEL+E Sbjct: 650 VKDKSHPQCDEIYQCLMELKRQMELVE 676 >ref|XP_023898683.1| pentatricopeptide repeat-containing protein At2g22410, mitochondrial [Quercus suber] Length = 669 Score = 138 bits (348), Expect = 7e-34 Identities = 68/91 (74%), Positives = 78/91 (85%) Frame = -2 Query: 715 KLLELDPDDSGIYVLLANMYVERNMWQKAGEVRKMMRERGVDKTPGCSSIEVNGNVYEFI 536 KLLELDP DSGIYVLLANMY + NMW++A +VRKMM ERGV+KTPGCSSIEVNG VYEFI Sbjct: 579 KLLELDPGDSGIYVLLANMYGDANMWEEAKKVRKMMGERGVEKTPGCSSIEVNGIVYEFI 638 Query: 535 VRDKSHSQTGHIYECLVQLSKQMELLEDEFL 443 VRDKSH Q+ IYECLVQL++Q EL+ +L Sbjct: 639 VRDKSHPQSEQIYECLVQLTRQSELVYPIYL 669 >ref|XP_022154126.1| pentatricopeptide repeat-containing protein At2g22410, mitochondrial [Momordica charantia] ref|XP_022154127.1| pentatricopeptide repeat-containing protein At2g22410, mitochondrial [Momordica charantia] ref|XP_022154128.1| pentatricopeptide repeat-containing protein At2g22410, mitochondrial [Momordica charantia] ref|XP_022154129.1| pentatricopeptide repeat-containing protein At2g22410, mitochondrial [Momordica charantia] Length = 682 Score = 138 bits (347), Expect = 1e-33 Identities = 64/89 (71%), Positives = 79/89 (88%) Frame = -2 Query: 715 KLLELDPDDSGIYVLLANMYVERNMWQKAGEVRKMMRERGVDKTPGCSSIEVNGNVYEFI 536 KLLELDP DSGIYVLLANMY + NMW++A +VRKMM ERGV+KTPGCSSIE+NG V+EFI Sbjct: 583 KLLELDPHDSGIYVLLANMYGDANMWEQARKVRKMMEERGVEKTPGCSSIEMNGVVFEFI 642 Query: 535 VRDKSHSQTGHIYECLVQLSKQMELLEDE 449 +RD+SH Q+ IYECL +L++Q+EL+EDE Sbjct: 643 IRDQSHPQSEKIYECLTRLTRQLELVEDE 671 >gb|OMO78085.1| hypothetical protein COLO4_24857 [Corchorus olitorius] Length = 495 Score = 136 bits (342), Expect = 1e-33 Identities = 66/103 (64%), Positives = 82/103 (79%), Gaps = 9/103 (8%) Frame = -2 Query: 715 KLLELDPDDSGIYVLLANMYVERNMWQKAGEVRKMMRERGVDKTPGCSSIEVNGNVYEFI 536 KLLELDP DSGIYVLLANMY + NMW++A +VRKMM +RGVDKTPGCSSIEVNG VYEFI Sbjct: 393 KLLELDPHDSGIYVLLANMYGDANMWEEARKVRKMMSDRGVDKTPGCSSIEVNGTVYEFI 452 Query: 535 VRDKSHSQTGHIYECLVQLSKQMELLE---------DEFLFGS 434 VRDKSH ++ IY+CL++L++ +E +E ++FL GS Sbjct: 453 VRDKSHPKSDQIYDCLIRLTQHLEFVEFTHGLPKYNNDFLLGS 495 >gb|EOY32615.1| Slow growth 1, putative [Theobroma cacao] Length = 702 Score = 137 bits (346), Expect = 1e-33 Identities = 66/105 (62%), Positives = 83/105 (79%), Gaps = 9/105 (8%) Frame = -2 Query: 715 KLLELDPDDSGIYVLLANMYVERNMWQKAGEVRKMMRERGVDKTPGCSSIEVNGNVYEFI 536 KLLELDP DSGIYVLLANMY + MW++AG+VRKMM+ERGV KTPGCSSIE+NG VYEFI Sbjct: 586 KLLELDPHDSGIYVLLANMYGDAKMWEEAGKVRKMMKERGVGKTPGCSSIELNGTVYEFI 645 Query: 535 VRDKSHSQTGHIYECLVQLSKQMELLE---------DEFLFGSEV 428 VRDKSH +T IY+CL+QL++ ++ +E ++FL G E+ Sbjct: 646 VRDKSHPETQQIYDCLIQLTRHLDFVEFTYGLPKCYNDFLLGLEL 690 >ref|XP_022754258.1| pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like isoform X2 [Durio zibethinus] Length = 649 Score = 137 bits (345), Expect = 2e-33 Identities = 66/105 (62%), Positives = 83/105 (79%), Gaps = 9/105 (8%) Frame = -2 Query: 715 KLLELDPDDSGIYVLLANMYVERNMWQKAGEVRKMMRERGVDKTPGCSSIEVNGNVYEFI 536 KLLELDP DSGIYVLLANMY + NMW++AG+VRKMMRERGV+KTPGCSSIEV+G YEFI Sbjct: 543 KLLELDPHDSGIYVLLANMYGDANMWEEAGKVRKMMRERGVEKTPGCSSIEVDGTAYEFI 602 Query: 535 VRDKSHSQTGHIYECLVQLSKQMELLE---------DEFLFGSEV 428 VRD SH ++ IY+C++QL++Q+E E ++FL G E+ Sbjct: 603 VRDTSHPESEQIYDCIIQLTRQLEFAEFTCGLPKYYNDFLVGLEL 647 >ref|XP_022754257.1| pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like isoform X1 [Durio zibethinus] Length = 689 Score = 137 bits (345), Expect = 2e-33 Identities = 66/105 (62%), Positives = 83/105 (79%), Gaps = 9/105 (8%) Frame = -2 Query: 715 KLLELDPDDSGIYVLLANMYVERNMWQKAGEVRKMMRERGVDKTPGCSSIEVNGNVYEFI 536 KLLELDP DSGIYVLLANMY + NMW++AG+VRKMMRERGV+KTPGCSSIEV+G YEFI Sbjct: 583 KLLELDPHDSGIYVLLANMYGDANMWEEAGKVRKMMRERGVEKTPGCSSIEVDGTAYEFI 642 Query: 535 VRDKSHSQTGHIYECLVQLSKQMELLE---------DEFLFGSEV 428 VRD SH ++ IY+C++QL++Q+E E ++FL G E+ Sbjct: 643 VRDTSHPESEQIYDCIIQLTRQLEFAEFTCGLPKYYNDFLVGLEL 687 >ref|XP_021277920.1| LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Herrania umbratica] Length = 702 Score = 137 bits (345), Expect = 2e-33 Identities = 64/93 (68%), Positives = 78/93 (83%) Frame = -2 Query: 715 KLLELDPDDSGIYVLLANMYVERNMWQKAGEVRKMMRERGVDKTPGCSSIEVNGNVYEFI 536 KLLELDP DSGIYVLLANMY + NMW++AG VR MM+E+GV KTPGCSSIEVNG VYEFI Sbjct: 586 KLLELDPHDSGIYVLLANMYGDANMWEEAGXVRNMMKEKGVGKTPGCSSIEVNGTVYEFI 645 Query: 535 VRDKSHSQTGHIYECLVQLSKQMELLEDEFLFG 437 VRDKSH +T +Y+CL+QL++ +E EF++G Sbjct: 646 VRDKSHPETQXVYDCLIQLTRHLEFA--EFIYG 676