BLASTX nr result
ID: Rehmannia29_contig00036997
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00036997 (537 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011081143.1| ankyrin repeat-containing protein BDA1-like ... 62 6e-08 gb|PIN08544.1| hypothetical protein CDL12_18882 [Handroanthus im... 56 5e-06 >ref|XP_011081143.1| ankyrin repeat-containing protein BDA1-like [Sesamum indicum] Length = 482 Score = 62.0 bits (149), Expect = 6e-08 Identities = 35/72 (48%), Positives = 42/72 (58%) Frame = -1 Query: 243 ARELPLKQPLNQYLLSQPTYMENLVRGFHFMIADLTNDMRNXXXXXXXXXXXXTYQAVLQ 64 A +LP KQ L QYL S T E+L+R +FM +LT DMR+ TYQ VLQ Sbjct: 256 AADLPKKQTLTQYLHSPVTRYEDLLRREYFMHKELTVDMRSVILVVAVLIATATYQVVLQ 315 Query: 63 PPGGPYQGNGDA 28 PPGG YQG D+ Sbjct: 316 PPGGVYQGQADS 327 >gb|PIN08544.1| hypothetical protein CDL12_18882 [Handroanthus impetiginosus] Length = 382 Score = 56.2 bits (134), Expect = 5e-06 Identities = 30/71 (42%), Positives = 39/71 (54%) Frame = -1 Query: 243 ARELPLKQPLNQYLLSQPTYMENLVRGFHFMIADLTNDMRNXXXXXXXXXXXXTYQAVLQ 64 A++LP QYL S T E+ +RG++F D ++RN TYQAVLQ Sbjct: 151 AKQLPQIHRRGQYLQSNVTSAEDFLRGYYFTYKDFVLNLRNDIMVFAVLIATATYQAVLQ 210 Query: 63 PPGGPYQGNGD 31 PPGG YQ NG+ Sbjct: 211 PPGGVYQPNGN 221