BLASTX nr result
ID: Rehmannia29_contig00036883
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00036883 (635 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTG03473.1| putative bystin [Helianthus annuus] 61 3e-07 >gb|OTG03473.1| putative bystin [Helianthus annuus] Length = 457 Score = 60.8 bits (146), Expect = 3e-07 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = -1 Query: 131 LVLILLAPFYNYVFLDSRAPTPLSIVTKTIQEDRFDIPDVPME 3 L+ + + FYN+ FL+S +P+P+S++ KTI EDRFDIPDVPME Sbjct: 413 LMFVTVNSFYNFYFLNSVSPSPISVINKTIDEDRFDIPDVPME 455