BLASTX nr result
ID: Rehmannia29_contig00036402
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00036402 (382 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011070550.1| putative late blight resistance protein homo... 87 3e-17 >ref|XP_011070550.1| putative late blight resistance protein homolog R1A-10 [Sesamum indicum] ref|XP_020547664.1| putative late blight resistance protein homolog R1A-10 [Sesamum indicum] Length = 910 Score = 87.0 bits (214), Expect = 3e-17 Identities = 43/64 (67%), Positives = 51/64 (79%) Frame = +1 Query: 190 MPYAAVTSLLQTLDLVVSPDANLTPQDNEQFSYLGEKLMYLKSFLEGFVKRRGDYKNVKI 369 M YAAV SLLQTLDLV+ P+ LT QD++QF+ LGEKL YLK FLEGFV+ RGD+ VK+ Sbjct: 1 MAYAAVNSLLQTLDLVIFPNPYLTSQDDDQFASLGEKLRYLKGFLEGFVRSRGDHGKVKV 60 Query: 370 LETQ 381 LE Q Sbjct: 61 LERQ 64