BLASTX nr result
ID: Rehmannia29_contig00036375
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00036375 (826 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB43848.1| hypothetical protein B456_007G219500 [Gossypium r... 108 2e-23 ref|XP_022773939.1| probable indole-3-acetic acid-amido syntheta... 109 2e-23 ref|XP_012079335.1| probable indole-3-acetic acid-amido syntheta... 109 3e-23 ref|XP_021632253.1| probable indole-3-acetic acid-amido syntheta... 109 3e-23 gb|ACF83491.1| unknown [Zea mays] 100 3e-23 ref|XP_021635299.1| probable indole-3-acetic acid-amido syntheta... 108 4e-23 gb|KJB43849.1| hypothetical protein B456_007G219500 [Gossypium r... 108 5e-23 gb|ONM59319.1| putative indole-3-acetic acid-amido synthetase GH... 100 5e-23 ref|XP_003611653.1| indole-3-acetic acid-amido synthetase [Medic... 108 6e-23 ref|XP_006380674.1| hypothetical protein POPTR_0007s10350g [Popu... 108 8e-23 gb|PPD94172.1| hypothetical protein GOBAR_DD08815 [Gossypium bar... 108 8e-23 ref|XP_022752084.1| probable indole-3-acetic acid-amido syntheta... 108 8e-23 gb|OMP01872.1| GH3 auxin-responsive promoter [Corchorus olitorius] 108 8e-23 gb|OMO56548.1| GH3 auxin-responsive promoter [Corchorus capsularis] 108 8e-23 ref|XP_012491908.1| PREDICTED: probable indole-3-acetic acid-ami... 108 8e-23 emb|CDO97243.1| unnamed protein product [Coffea canephora] 102 1e-22 ref|XP_021651490.1| indole-3-acetic acid-amido synthetase GH3.3-... 107 1e-22 gb|KNA19035.1| hypothetical protein SOVF_065410 [Spinacia oleracea] 105 2e-22 ref|XP_021668431.1| probable indole-3-acetic acid-amido syntheta... 107 2e-22 gb|OMO63305.1| GH3 auxin-responsive promoter [Corchorus olitorius] 107 2e-22 >gb|KJB43848.1| hypothetical protein B456_007G219500 [Gossypium raimondii] Length = 390 Score = 108 bits (269), Expect = 2e-23 Identities = 51/59 (86%), Positives = 55/59 (93%) Frame = +1 Query: 1 RVVKNGTFEELMDYAISMGASISQYKVPRCVSSKPIVDLLDSRVVSKHFSPSLPHWTSE 177 RVVKNGTFEELMDYAIS GASI+QYKVPRCVS PI++LLDSRVVSKHFSP+LPHWT E Sbjct: 329 RVVKNGTFEELMDYAISRGASINQYKVPRCVSFTPIMELLDSRVVSKHFSPALPHWTPE 387 >ref|XP_022773939.1| probable indole-3-acetic acid-amido synthetase GH3.1 [Durio zibethinus] Length = 598 Score = 109 bits (273), Expect = 2e-23 Identities = 52/59 (88%), Positives = 55/59 (93%) Frame = +1 Query: 1 RVVKNGTFEELMDYAISMGASISQYKVPRCVSSKPIVDLLDSRVVSKHFSPSLPHWTSE 177 RVVKNGTFEELMDYAIS GASI+QYKVPRCVS PI+DLLDSRVVSKHFSP+LPHWT E Sbjct: 537 RVVKNGTFEELMDYAISRGASINQYKVPRCVSFTPIMDLLDSRVVSKHFSPALPHWTPE 595 >ref|XP_012079335.1| probable indole-3-acetic acid-amido synthetase GH3.1 [Jatropha curcas] gb|KDP32021.1| hypothetical protein JCGZ_12482 [Jatropha curcas] Length = 597 Score = 109 bits (272), Expect = 3e-23 Identities = 52/59 (88%), Positives = 55/59 (93%) Frame = +1 Query: 1 RVVKNGTFEELMDYAISMGASISQYKVPRCVSSKPIVDLLDSRVVSKHFSPSLPHWTSE 177 RVVKNGTFEELMDYAIS GASI+QYKVPRCVS PI++LLDSRVVSKHFSPSLPHWT E Sbjct: 536 RVVKNGTFEELMDYAISRGASINQYKVPRCVSFTPIMELLDSRVVSKHFSPSLPHWTPE 594 >ref|XP_021632253.1| probable indole-3-acetic acid-amido synthetase GH3.1 [Manihot esculenta] gb|OAY33682.1| hypothetical protein MANES_13G116000 [Manihot esculenta] Length = 598 Score = 109 bits (272), Expect = 3e-23 Identities = 52/59 (88%), Positives = 55/59 (93%) Frame = +1 Query: 1 RVVKNGTFEELMDYAISMGASISQYKVPRCVSSKPIVDLLDSRVVSKHFSPSLPHWTSE 177 RVVKNGTFEELMDYAIS GASI+QYKVPRCVS PI++LLDSRVVSKHFSPSLPHWT E Sbjct: 537 RVVKNGTFEELMDYAISRGASINQYKVPRCVSFTPIMELLDSRVVSKHFSPSLPHWTPE 595 >gb|ACF83491.1| unknown [Zea mays] Length = 89 Score = 100 bits (248), Expect = 3e-23 Identities = 46/57 (80%), Positives = 52/57 (91%) Frame = +1 Query: 1 RVVKNGTFEELMDYAISMGASISQYKVPRCVSSKPIVDLLDSRVVSKHFSPSLPHWT 171 RVV+ GTFEELMDYAIS GASI+QYKVPRCV+ PI++LLDSRVVS HFSP+LPHWT Sbjct: 25 RVVRPGTFEELMDYAISRGASINQYKVPRCVTFPPIIELLDSRVVSSHFSPALPHWT 81 >ref|XP_021635299.1| probable indole-3-acetic acid-amido synthetase GH3.1 [Hevea brasiliensis] Length = 597 Score = 108 bits (271), Expect = 4e-23 Identities = 52/59 (88%), Positives = 54/59 (91%) Frame = +1 Query: 1 RVVKNGTFEELMDYAISMGASISQYKVPRCVSSKPIVDLLDSRVVSKHFSPSLPHWTSE 177 RVVKNGTFEELMDYAIS GASI+QYKVPRCVS PI +LLDSRVVSKHFSPSLPHWT E Sbjct: 536 RVVKNGTFEELMDYAISRGASINQYKVPRCVSFTPITELLDSRVVSKHFSPSLPHWTPE 594 >gb|KJB43849.1| hypothetical protein B456_007G219500 [Gossypium raimondii] Length = 481 Score = 108 bits (269), Expect = 5e-23 Identities = 51/59 (86%), Positives = 55/59 (93%) Frame = +1 Query: 1 RVVKNGTFEELMDYAISMGASISQYKVPRCVSSKPIVDLLDSRVVSKHFSPSLPHWTSE 177 RVVKNGTFEELMDYAIS GASI+QYKVPRCVS PI++LLDSRVVSKHFSP+LPHWT E Sbjct: 420 RVVKNGTFEELMDYAISRGASINQYKVPRCVSFTPIMELLDSRVVSKHFSPALPHWTPE 478 >gb|ONM59319.1| putative indole-3-acetic acid-amido synthetase GH3.1 [Zea mays] Length = 106 Score = 100 bits (248), Expect = 5e-23 Identities = 46/57 (80%), Positives = 52/57 (91%) Frame = +1 Query: 1 RVVKNGTFEELMDYAISMGASISQYKVPRCVSSKPIVDLLDSRVVSKHFSPSLPHWT 171 RVV+ GTFEELMDYAIS GASI+QYKVPRCV+ PI++LLDSRVVS HFSP+LPHWT Sbjct: 42 RVVRPGTFEELMDYAISRGASINQYKVPRCVTFPPIIELLDSRVVSSHFSPALPHWT 98 >ref|XP_003611653.1| indole-3-acetic acid-amido synthetase [Medicago truncatula] gb|AES94611.1| indole-3-acetic acid-amido synthetase [Medicago truncatula] Length = 600 Score = 108 bits (270), Expect = 6e-23 Identities = 52/59 (88%), Positives = 55/59 (93%) Frame = +1 Query: 1 RVVKNGTFEELMDYAISMGASISQYKVPRCVSSKPIVDLLDSRVVSKHFSPSLPHWTSE 177 RVVKNGTFEELMDYAIS GASI+QYKVPRCVS PI++LLDSRVVS HFSPSLPHWTSE Sbjct: 539 RVVKNGTFEELMDYAISRGASINQYKVPRCVSFTPIMELLDSRVVSVHFSPSLPHWTSE 597 >ref|XP_006380674.1| hypothetical protein POPTR_0007s10350g [Populus trichocarpa] gb|PNT27197.1| hypothetical protein POPTR_007G050300v3 [Populus trichocarpa] Length = 597 Score = 108 bits (269), Expect = 8e-23 Identities = 51/59 (86%), Positives = 55/59 (93%) Frame = +1 Query: 1 RVVKNGTFEELMDYAISMGASISQYKVPRCVSSKPIVDLLDSRVVSKHFSPSLPHWTSE 177 RVVKNGTFEELMDYAIS GASI+QYKVPRCVS PI++LLDSRVVSKHFSPS+PHWT E Sbjct: 536 RVVKNGTFEELMDYAISRGASINQYKVPRCVSFTPIMELLDSRVVSKHFSPSVPHWTPE 594 >gb|PPD94172.1| hypothetical protein GOBAR_DD08815 [Gossypium barbadense] Length = 598 Score = 108 bits (269), Expect = 8e-23 Identities = 51/59 (86%), Positives = 55/59 (93%) Frame = +1 Query: 1 RVVKNGTFEELMDYAISMGASISQYKVPRCVSSKPIVDLLDSRVVSKHFSPSLPHWTSE 177 RVVKNGTFEELMDYAIS GASI+QYKVPRCVS PI++LLDSRVVSKHFSP+LPHWT E Sbjct: 537 RVVKNGTFEELMDYAISRGASINQYKVPRCVSFTPIMELLDSRVVSKHFSPALPHWTPE 595 >ref|XP_022752084.1| probable indole-3-acetic acid-amido synthetase GH3.1 [Durio zibethinus] Length = 598 Score = 108 bits (269), Expect = 8e-23 Identities = 51/59 (86%), Positives = 55/59 (93%) Frame = +1 Query: 1 RVVKNGTFEELMDYAISMGASISQYKVPRCVSSKPIVDLLDSRVVSKHFSPSLPHWTSE 177 RVVKNGTFEELMDYAIS GASI+QYKVPRCVS PI++LLDSRVVSKHFSP+LPHWT E Sbjct: 537 RVVKNGTFEELMDYAISRGASINQYKVPRCVSFTPIMELLDSRVVSKHFSPALPHWTPE 595 >gb|OMP01872.1| GH3 auxin-responsive promoter [Corchorus olitorius] Length = 599 Score = 108 bits (269), Expect = 8e-23 Identities = 51/59 (86%), Positives = 55/59 (93%) Frame = +1 Query: 1 RVVKNGTFEELMDYAISMGASISQYKVPRCVSSKPIVDLLDSRVVSKHFSPSLPHWTSE 177 RVVKNGTFEELMDYAIS GASI+QYKVPRCVS PI++LLDSRVVSKHFSP+LPHWT E Sbjct: 538 RVVKNGTFEELMDYAISRGASINQYKVPRCVSFTPIMELLDSRVVSKHFSPALPHWTPE 596 >gb|OMO56548.1| GH3 auxin-responsive promoter [Corchorus capsularis] Length = 599 Score = 108 bits (269), Expect = 8e-23 Identities = 51/59 (86%), Positives = 55/59 (93%) Frame = +1 Query: 1 RVVKNGTFEELMDYAISMGASISQYKVPRCVSSKPIVDLLDSRVVSKHFSPSLPHWTSE 177 RVVKNGTFEELMDYAIS GASI+QYKVPRCVS PI++LLDSRVVSKHFSP+LPHWT E Sbjct: 538 RVVKNGTFEELMDYAISRGASINQYKVPRCVSFTPIMELLDSRVVSKHFSPALPHWTPE 596 >ref|XP_012491908.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 [Gossypium raimondii] gb|KJB43847.1| hypothetical protein B456_007G219500 [Gossypium raimondii] Length = 606 Score = 108 bits (269), Expect = 8e-23 Identities = 51/59 (86%), Positives = 55/59 (93%) Frame = +1 Query: 1 RVVKNGTFEELMDYAISMGASISQYKVPRCVSSKPIVDLLDSRVVSKHFSPSLPHWTSE 177 RVVKNGTFEELMDYAIS GASI+QYKVPRCVS PI++LLDSRVVSKHFSP+LPHWT E Sbjct: 545 RVVKNGTFEELMDYAISRGASINQYKVPRCVSFTPIMELLDSRVVSKHFSPALPHWTPE 603 >emb|CDO97243.1| unnamed protein product [Coffea canephora] Length = 235 Score = 102 bits (255), Expect = 1e-22 Identities = 50/59 (84%), Positives = 53/59 (89%) Frame = +1 Query: 1 RVVKNGTFEELMDYAISMGASISQYKVPRCVSSKPIVDLLDSRVVSKHFSPSLPHWTSE 177 RVVK+GTFEELMDYAIS GASI+QYKVPRCVS PIV+LLDSRVVS HFSPSLP WT E Sbjct: 174 RVVKSGTFEELMDYAISRGASINQYKVPRCVSFTPIVELLDSRVVSVHFSPSLPRWTPE 232 >ref|XP_021651490.1| indole-3-acetic acid-amido synthetase GH3.3-like [Hevea brasiliensis] Length = 596 Score = 107 bits (267), Expect = 1e-22 Identities = 51/59 (86%), Positives = 54/59 (91%) Frame = +1 Query: 1 RVVKNGTFEELMDYAISMGASISQYKVPRCVSSKPIVDLLDSRVVSKHFSPSLPHWTSE 177 RVVKNGTFEELMDYAIS GASI+QYKVPRCVS PI++LLDSRVVS HFSPSLPHWT E Sbjct: 535 RVVKNGTFEELMDYAISRGASINQYKVPRCVSFTPIMELLDSRVVSNHFSPSLPHWTPE 593 >gb|KNA19035.1| hypothetical protein SOVF_065410 [Spinacia oleracea] Length = 384 Score = 105 bits (262), Expect = 2e-22 Identities = 49/59 (83%), Positives = 55/59 (93%) Frame = +1 Query: 1 RVVKNGTFEELMDYAISMGASISQYKVPRCVSSKPIVDLLDSRVVSKHFSPSLPHWTSE 177 RVVKNGTFEELMDYAIS GASI+QYKVPRCV+ KPIV+LLDSRVVS H+SPSLPHW+ + Sbjct: 322 RVVKNGTFEELMDYAISRGASINQYKVPRCVNVKPIVELLDSRVVSAHYSPSLPHWSPQ 380 >ref|XP_021668431.1| probable indole-3-acetic acid-amido synthetase GH3.1 isoform X1 [Hevea brasiliensis] ref|XP_021668432.1| probable indole-3-acetic acid-amido synthetase GH3.1 isoform X2 [Hevea brasiliensis] Length = 599 Score = 107 bits (266), Expect = 2e-22 Identities = 50/59 (84%), Positives = 55/59 (93%) Frame = +1 Query: 1 RVVKNGTFEELMDYAISMGASISQYKVPRCVSSKPIVDLLDSRVVSKHFSPSLPHWTSE 177 RVVKNGTFEELMDYAIS GASI+QYKVPRCV+ PI++LLDSRVVS+HFSPSLPHWT E Sbjct: 537 RVVKNGTFEELMDYAISRGASINQYKVPRCVNFTPIMELLDSRVVSRHFSPSLPHWTPE 595 >gb|OMO63305.1| GH3 auxin-responsive promoter [Corchorus olitorius] Length = 599 Score = 107 bits (266), Expect = 2e-22 Identities = 50/59 (84%), Positives = 55/59 (93%) Frame = +1 Query: 1 RVVKNGTFEELMDYAISMGASISQYKVPRCVSSKPIVDLLDSRVVSKHFSPSLPHWTSE 177 RVVKNGTFEELMDYAIS GASI+QYKVPRCV+ PI++LLDSRVVSKHFSP+LPHWT E Sbjct: 538 RVVKNGTFEELMDYAISRGASINQYKVPRCVNFTPIMELLDSRVVSKHFSPALPHWTPE 596