BLASTX nr result
ID: Rehmannia29_contig00036129
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00036129 (460 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011101595.1| uncharacterized protein LOC105179654 [Sesamu... 59 3e-07 >ref|XP_011101595.1| uncharacterized protein LOC105179654 [Sesamum indicum] Length = 765 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 1 CRIPTLLQPKVTFANYIEERAIPVLDPSTST*KK 102 CRIP LLQPKVTFANYI+ERA PV+DPSTS K Sbjct: 731 CRIPALLQPKVTFANYIQERAFPVIDPSTSAQNK 764