BLASTX nr result
ID: Rehmannia29_contig00035999
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00035999 (476 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011070114.1| wall-associated receptor kinase 5-like [Sesa... 68 4e-10 ref|XP_020547790.1| LOW QUALITY PROTEIN: wall-associated recepto... 66 2e-09 ref|XP_020554137.1| wall-associated receptor kinase 5-like [Sesa... 66 2e-09 gb|PIN12641.1| Serine/threonine protein kinase [Handroanthus imp... 60 2e-07 ref|XP_011085614.1| wall-associated receptor kinase 2 [Sesamum i... 59 6e-07 ref|XP_012830196.1| PREDICTED: wall-associated receptor kinase 5... 55 9e-06 >ref|XP_011070114.1| wall-associated receptor kinase 5-like [Sesamum indicum] Length = 719 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = +1 Query: 112 DFDECANTKDNNCPVENLCVNTAGSYYCLPNRRRIFVVLIALG 240 D DEC+N +DNNCPV+ CVNT GSY+CLPNR R+ +LI LG Sbjct: 291 DIDECSNREDNNCPVKTHCVNTEGSYFCLPNRTRMLELLIPLG 333 >ref|XP_020547790.1| LOW QUALITY PROTEIN: wall-associated receptor kinase 5-like [Sesamum indicum] Length = 718 Score = 65.9 bits (159), Expect = 2e-09 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = +1 Query: 112 DFDECANTKDNNCPVENLCVNTAGSYYCLPNRRRIFVVLIALG 240 D DEC+N +DNNCPV+ CVNT GSY+CLP+R R+ +LI LG Sbjct: 291 DVDECSNREDNNCPVKTRCVNTEGSYFCLPSRTRMLELLIPLG 333 >ref|XP_020554137.1| wall-associated receptor kinase 5-like [Sesamum indicum] Length = 719 Score = 65.9 bits (159), Expect = 2e-09 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = +1 Query: 112 DFDECANTKDNNCPVENLCVNTAGSYYCLPNRRRIFVVLIALG 240 D DEC+N +DNNCPV+ CVNT GSY+CLPNR R +LI LG Sbjct: 291 DVDECSNWEDNNCPVKTHCVNTHGSYFCLPNRTRTLELLIPLG 333 >gb|PIN12641.1| Serine/threonine protein kinase [Handroanthus impetiginosus] Length = 453 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/50 (54%), Positives = 32/50 (64%) Frame = +1 Query: 91 VALNTTADFDECANTKDNNCPVENLCVNTAGSYYCLPNRRRIFVVLIALG 240 V L + FDECAN K NNC + CVNT GSY+C PN R F +L+ LG Sbjct: 42 VLLTSLGYFDECANPKYNNCSKGSSCVNTQGSYHCSPNHGRFFALLVPLG 91 >ref|XP_011085614.1| wall-associated receptor kinase 2 [Sesamum indicum] Length = 723 Score = 58.5 bits (140), Expect = 6e-07 Identities = 22/43 (51%), Positives = 29/43 (67%) Frame = +1 Query: 112 DFDECANTKDNNCPVENLCVNTAGSYYCLPNRRRIFVVLIALG 240 D DECAN KDN CP ++ C N G ++CLP+RR +F L +G Sbjct: 294 DIDECANQKDNECPTKHRCFNVEGGFFCLPSRRHMFAELFPIG 336 >ref|XP_012830196.1| PREDICTED: wall-associated receptor kinase 5-like [Erythranthe guttata] Length = 717 Score = 55.1 bits (131), Expect = 9e-06 Identities = 28/45 (62%), Positives = 30/45 (66%), Gaps = 2/45 (4%) Frame = +1 Query: 112 DFDECANTK-DNNCPVENLCVNTAGSYYCLP-NRRRIFVVLIALG 240 D DEC K N CP +LCVNTAG YYC P +RR F VLIALG Sbjct: 284 DIDECGEAKYKNTCPKNDLCVNTAGGYYCSPYHRRNRFPVLIALG 328