BLASTX nr result
ID: Rehmannia29_contig00035740
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00035740 (412 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKI55833.1| hypothetical protein CRG98_023775 [Punica granatum] 126 4e-31 gb|OWM72069.1| hypothetical protein CDL15_Pgr017952 [Punica gran... 126 5e-31 ref|XP_011084681.1| pentatricopeptide repeat-containing protein ... 126 6e-31 ref|XP_021280423.1| pentatricopeptide repeat-containing protein ... 126 6e-31 ref|XP_007050539.2| PREDICTED: pentatricopeptide repeat-containi... 126 6e-31 gb|OMP01443.1| hypothetical protein COLO4_11874 [Corchorus olito... 124 2e-30 gb|EOX94696.1| Pentatricopeptide repeat (PPR) superfamily protei... 124 2e-30 ref|XP_018833062.1| PREDICTED: pentatricopeptide repeat-containi... 124 2e-30 ref|XP_022758264.1| pentatricopeptide repeat-containing protein ... 124 4e-30 gb|OMO54430.1| hypothetical protein CCACVL1_27806 [Corchorus cap... 123 5e-30 ref|XP_021664856.1| pentatricopeptide repeat-containing protein ... 123 5e-30 gb|PPE00719.1| hypothetical protein GOBAR_DD02221 [Gossypium bar... 123 6e-30 ref|XP_021664844.1| pentatricopeptide repeat-containing protein ... 123 6e-30 ref|XP_012473539.1| PREDICTED: pentatricopeptide repeat-containi... 123 8e-30 ref|XP_012081319.1| pentatricopeptide repeat-containing protein ... 122 9e-30 ref|XP_010086604.2| pentatricopeptide repeat-containing protein ... 122 1e-29 ref|XP_020537877.1| pentatricopeptide repeat-containing protein ... 122 1e-29 gb|EXB22115.1| hypothetical protein L484_002429 [Morus notabilis] 122 1e-29 ref|XP_019266394.1| PREDICTED: pentatricopeptide repeat-containi... 122 1e-29 ref|XP_016451373.1| PREDICTED: pentatricopeptide repeat-containi... 122 1e-29 >gb|PKI55833.1| hypothetical protein CRG98_023775 [Punica granatum] Length = 736 Score = 126 bits (317), Expect = 4e-31 Identities = 60/67 (89%), Positives = 62/67 (92%) Frame = -1 Query: 412 RGGFFVRANEAVEMMEKGSMFIDKYKYRTLFLKYHKTLYKGKALKFQMESQLKKREAALV 233 RGGFFVRANE VEMMEKG MF+DKYKYRTLFLKYHKTLYKGKA KFQ E+QLKKREAAL Sbjct: 669 RGGFFVRANEVVEMMEKGKMFVDKYKYRTLFLKYHKTLYKGKAPKFQTEAQLKKREAALA 728 Query: 232 FKKWVGL 212 FKKWVGL Sbjct: 729 FKKWVGL 735 >gb|OWM72069.1| hypothetical protein CDL15_Pgr017952 [Punica granatum] Length = 780 Score = 126 bits (317), Expect = 5e-31 Identities = 60/67 (89%), Positives = 62/67 (92%) Frame = -1 Query: 412 RGGFFVRANEAVEMMEKGSMFIDKYKYRTLFLKYHKTLYKGKALKFQMESQLKKREAALV 233 RGGFFVRANE VEMMEKG MF+DKYKYRTLFLKYHKTLYKGKA KFQ E+QLKKREAAL Sbjct: 713 RGGFFVRANEVVEMMEKGKMFVDKYKYRTLFLKYHKTLYKGKAPKFQTEAQLKKREAALA 772 Query: 232 FKKWVGL 212 FKKWVGL Sbjct: 773 FKKWVGL 779 >ref|XP_011084681.1| pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Sesamum indicum] ref|XP_011084682.1| pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Sesamum indicum] Length = 770 Score = 126 bits (316), Expect = 6e-31 Identities = 60/67 (89%), Positives = 62/67 (92%) Frame = -1 Query: 412 RGGFFVRANEAVEMMEKGSMFIDKYKYRTLFLKYHKTLYKGKALKFQMESQLKKREAALV 233 RGGFF+RANE VEMMEKG+MFIDKYKYR LFLKYHKTLYKGKA KFQ ESQLKKREAAL Sbjct: 704 RGGFFIRANEVVEMMEKGNMFIDKYKYRALFLKYHKTLYKGKAPKFQTESQLKKREAALA 763 Query: 232 FKKWVGL 212 FKKWVGL Sbjct: 764 FKKWVGL 770 >ref|XP_021280423.1| pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Herrania umbratica] Length = 780 Score = 126 bits (316), Expect = 6e-31 Identities = 60/67 (89%), Positives = 63/67 (94%) Frame = -1 Query: 412 RGGFFVRANEAVEMMEKGSMFIDKYKYRTLFLKYHKTLYKGKALKFQMESQLKKREAALV 233 RGGFFVRANE V+MMEKG+MFIDKYKYRTLFLKYHKTLYKGKA KFQ E+QLKKREAAL Sbjct: 713 RGGFFVRANEVVDMMEKGNMFIDKYKYRTLFLKYHKTLYKGKAPKFQTEAQLKKREAALT 772 Query: 232 FKKWVGL 212 FKKWVGL Sbjct: 773 FKKWVGL 779 >ref|XP_007050539.2| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Theobroma cacao] Length = 780 Score = 126 bits (316), Expect = 6e-31 Identities = 60/67 (89%), Positives = 63/67 (94%) Frame = -1 Query: 412 RGGFFVRANEAVEMMEKGSMFIDKYKYRTLFLKYHKTLYKGKALKFQMESQLKKREAALV 233 RGGFFVRANE V+MMEKG+MFIDKYKYRTLFLKYHKTLYKGKA KFQ E+QLKKREAAL Sbjct: 713 RGGFFVRANEVVDMMEKGNMFIDKYKYRTLFLKYHKTLYKGKAPKFQTEAQLKKREAALT 772 Query: 232 FKKWVGL 212 FKKWVGL Sbjct: 773 FKKWVGL 779 >gb|OMP01443.1| hypothetical protein COLO4_11874 [Corchorus olitorius] Length = 708 Score = 124 bits (312), Expect = 2e-30 Identities = 60/67 (89%), Positives = 62/67 (92%) Frame = -1 Query: 412 RGGFFVRANEAVEMMEKGSMFIDKYKYRTLFLKYHKTLYKGKALKFQMESQLKKREAALV 233 RGGFF RANE V+MMEKG+MFIDKYKYRTLFLKYHKTLYKGKA KFQ ESQLKKREAAL Sbjct: 641 RGGFFGRANEVVDMMEKGNMFIDKYKYRTLFLKYHKTLYKGKAPKFQTESQLKKREAALT 700 Query: 232 FKKWVGL 212 FKKWVGL Sbjct: 701 FKKWVGL 707 >gb|EOX94696.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 780 Score = 124 bits (312), Expect = 2e-30 Identities = 59/67 (88%), Positives = 63/67 (94%) Frame = -1 Query: 412 RGGFFVRANEAVEMMEKGSMFIDKYKYRTLFLKYHKTLYKGKALKFQMESQLKKREAALV 233 RGGFFVRANE V++MEKG+MFIDKYKYRTLFLKYHKTLYKGKA KFQ E+QLKKREAAL Sbjct: 713 RGGFFVRANEVVDVMEKGNMFIDKYKYRTLFLKYHKTLYKGKAPKFQTEAQLKKREAALT 772 Query: 232 FKKWVGL 212 FKKWVGL Sbjct: 773 FKKWVGL 779 >ref|XP_018833062.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Juglans regia] Length = 785 Score = 124 bits (312), Expect = 2e-30 Identities = 59/67 (88%), Positives = 62/67 (92%) Frame = -1 Query: 412 RGGFFVRANEAVEMMEKGSMFIDKYKYRTLFLKYHKTLYKGKALKFQMESQLKKREAALV 233 RG FFVRANE VEMMEKG+MF+DKYKYRTLFLKYHKTLYKGKA KFQ E+QLKKREAAL Sbjct: 718 RGAFFVRANEVVEMMEKGNMFVDKYKYRTLFLKYHKTLYKGKAPKFQTEAQLKKREAALT 777 Query: 232 FKKWVGL 212 FKKWVGL Sbjct: 778 FKKWVGL 784 >ref|XP_022758264.1| pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Durio zibethinus] Length = 790 Score = 124 bits (310), Expect = 4e-30 Identities = 60/67 (89%), Positives = 62/67 (92%) Frame = -1 Query: 412 RGGFFVRANEAVEMMEKGSMFIDKYKYRTLFLKYHKTLYKGKALKFQMESQLKKREAALV 233 RGGFFVRANE V+M EKG+MFIDKYKYRTLFLKYHKTLYKGKA KFQ ESQLKKREAAL Sbjct: 723 RGGFFVRANEVVDMTEKGNMFIDKYKYRTLFLKYHKTLYKGKAPKFQTESQLKKREAALG 782 Query: 232 FKKWVGL 212 FKKWVGL Sbjct: 783 FKKWVGL 789 >gb|OMO54430.1| hypothetical protein CCACVL1_27806 [Corchorus capsularis] Length = 708 Score = 123 bits (309), Expect = 5e-30 Identities = 59/67 (88%), Positives = 62/67 (92%) Frame = -1 Query: 412 RGGFFVRANEAVEMMEKGSMFIDKYKYRTLFLKYHKTLYKGKALKFQMESQLKKREAALV 233 RGGFF RANE V++MEKG+MFIDKYKYRTLFLKYHKTLYKGKA KFQ ESQLKKREAAL Sbjct: 641 RGGFFGRANEVVDLMEKGNMFIDKYKYRTLFLKYHKTLYKGKAPKFQTESQLKKREAALT 700 Query: 232 FKKWVGL 212 FKKWVGL Sbjct: 701 FKKWVGL 707 >ref|XP_021664856.1| pentatricopeptide repeat-containing protein At1g03100, mitochondrial isoform X2 [Hevea brasiliensis] Length = 721 Score = 123 bits (309), Expect = 5e-30 Identities = 59/67 (88%), Positives = 63/67 (94%) Frame = -1 Query: 412 RGGFFVRANEAVEMMEKGSMFIDKYKYRTLFLKYHKTLYKGKALKFQMESQLKKREAALV 233 RGGFFVRANE V+MMEKG+MFIDKYKYRTLFLKYHKTL+KGKA KFQ E+QLKKREAAL Sbjct: 654 RGGFFVRANEVVDMMEKGNMFIDKYKYRTLFLKYHKTLHKGKAPKFQTEAQLKKREAALS 713 Query: 232 FKKWVGL 212 FKKWVGL Sbjct: 714 FKKWVGL 720 >gb|PPE00719.1| hypothetical protein GOBAR_DD02221 [Gossypium barbadense] Length = 778 Score = 123 bits (309), Expect = 6e-30 Identities = 58/67 (86%), Positives = 62/67 (92%) Frame = -1 Query: 412 RGGFFVRANEAVEMMEKGSMFIDKYKYRTLFLKYHKTLYKGKALKFQMESQLKKREAALV 233 RGGFFVRANE V+MMEKG+MFIDKYKYRTL+LKYHKTLYKGK KFQ ESQLKKREAAL Sbjct: 711 RGGFFVRANEVVDMMEKGNMFIDKYKYRTLYLKYHKTLYKGKTPKFQTESQLKKREAALS 770 Query: 232 FKKWVGL 212 FKKW+GL Sbjct: 771 FKKWIGL 777 >ref|XP_021664844.1| pentatricopeptide repeat-containing protein At1g03100, mitochondrial isoform X1 [Hevea brasiliensis] ref|XP_021664845.1| pentatricopeptide repeat-containing protein At1g03100, mitochondrial isoform X1 [Hevea brasiliensis] ref|XP_021664846.1| pentatricopeptide repeat-containing protein At1g03100, mitochondrial isoform X1 [Hevea brasiliensis] ref|XP_021664847.1| pentatricopeptide repeat-containing protein At1g03100, mitochondrial isoform X1 [Hevea brasiliensis] ref|XP_021664848.1| pentatricopeptide repeat-containing protein At1g03100, mitochondrial isoform X1 [Hevea brasiliensis] ref|XP_021664849.1| pentatricopeptide repeat-containing protein At1g03100, mitochondrial isoform X1 [Hevea brasiliensis] ref|XP_021664850.1| pentatricopeptide repeat-containing protein At1g03100, mitochondrial isoform X1 [Hevea brasiliensis] ref|XP_021664851.1| pentatricopeptide repeat-containing protein At1g03100, mitochondrial isoform X1 [Hevea brasiliensis] ref|XP_021664852.1| pentatricopeptide repeat-containing protein At1g03100, mitochondrial isoform X1 [Hevea brasiliensis] ref|XP_021664853.1| pentatricopeptide repeat-containing protein At1g03100, mitochondrial isoform X1 [Hevea brasiliensis] ref|XP_021664854.1| pentatricopeptide repeat-containing protein At1g03100, mitochondrial isoform X1 [Hevea brasiliensis] ref|XP_021664855.1| pentatricopeptide repeat-containing protein At1g03100, mitochondrial isoform X1 [Hevea brasiliensis] Length = 787 Score = 123 bits (309), Expect = 6e-30 Identities = 59/67 (88%), Positives = 63/67 (94%) Frame = -1 Query: 412 RGGFFVRANEAVEMMEKGSMFIDKYKYRTLFLKYHKTLYKGKALKFQMESQLKKREAALV 233 RGGFFVRANE V+MMEKG+MFIDKYKYRTLFLKYHKTL+KGKA KFQ E+QLKKREAAL Sbjct: 720 RGGFFVRANEVVDMMEKGNMFIDKYKYRTLFLKYHKTLHKGKAPKFQTEAQLKKREAALS 779 Query: 232 FKKWVGL 212 FKKWVGL Sbjct: 780 FKKWVGL 786 >ref|XP_012473539.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Gossypium raimondii] gb|KJB22591.1| hypothetical protein B456_004G055800 [Gossypium raimondii] Length = 778 Score = 123 bits (308), Expect = 8e-30 Identities = 57/67 (85%), Positives = 62/67 (92%) Frame = -1 Query: 412 RGGFFVRANEAVEMMEKGSMFIDKYKYRTLFLKYHKTLYKGKALKFQMESQLKKREAALV 233 RGGFF+RANE V+MMEKG+MFIDKYKYRTL+LKYHKTLYKGK KFQ ESQLKKREAAL Sbjct: 711 RGGFFIRANEVVDMMEKGNMFIDKYKYRTLYLKYHKTLYKGKTPKFQTESQLKKREAALS 770 Query: 232 FKKWVGL 212 FKKW+GL Sbjct: 771 FKKWIGL 777 >ref|XP_012081319.1| pentatricopeptide repeat-containing protein At1g03100, mitochondrial isoform X4 [Jatropha curcas] Length = 683 Score = 122 bits (307), Expect = 9e-30 Identities = 58/67 (86%), Positives = 62/67 (92%) Frame = -1 Query: 412 RGGFFVRANEAVEMMEKGSMFIDKYKYRTLFLKYHKTLYKGKALKFQMESQLKKREAALV 233 RGGFFVRANE V+MMEKG+MF+DKYKYRTLFLKYHKTL+KGKA KFQ ESQLKKREA L Sbjct: 617 RGGFFVRANEVVDMMEKGNMFVDKYKYRTLFLKYHKTLHKGKAPKFQTESQLKKREAVLS 676 Query: 232 FKKWVGL 212 FKKWVGL Sbjct: 677 FKKWVGL 683 >ref|XP_010086604.2| pentatricopeptide repeat-containing protein At1g03100, mitochondrial isoform X2 [Morus notabilis] Length = 693 Score = 122 bits (307), Expect = 1e-29 Identities = 58/67 (86%), Positives = 61/67 (91%) Frame = -1 Query: 412 RGGFFVRANEAVEMMEKGSMFIDKYKYRTLFLKYHKTLYKGKALKFQMESQLKKREAALV 233 RGGFF RANE VEMMEKG+MF+DKYKYRTLFLKYHKTLYKGKA KFQ E+QL KREAAL Sbjct: 626 RGGFFKRANEVVEMMEKGNMFVDKYKYRTLFLKYHKTLYKGKAPKFQTEAQLSKREAALA 685 Query: 232 FKKWVGL 212 FKKWVGL Sbjct: 686 FKKWVGL 692 >ref|XP_020537877.1| pentatricopeptide repeat-containing protein At1g03100, mitochondrial isoform X3 [Jatropha curcas] Length = 728 Score = 122 bits (307), Expect = 1e-29 Identities = 58/67 (86%), Positives = 62/67 (92%) Frame = -1 Query: 412 RGGFFVRANEAVEMMEKGSMFIDKYKYRTLFLKYHKTLYKGKALKFQMESQLKKREAALV 233 RGGFFVRANE V+MMEKG+MF+DKYKYRTLFLKYHKTL+KGKA KFQ ESQLKKREA L Sbjct: 662 RGGFFVRANEVVDMMEKGNMFVDKYKYRTLFLKYHKTLHKGKAPKFQTESQLKKREAVLS 721 Query: 232 FKKWVGL 212 FKKWVGL Sbjct: 722 FKKWVGL 728 >gb|EXB22115.1| hypothetical protein L484_002429 [Morus notabilis] Length = 739 Score = 122 bits (307), Expect = 1e-29 Identities = 58/67 (86%), Positives = 61/67 (91%) Frame = -1 Query: 412 RGGFFVRANEAVEMMEKGSMFIDKYKYRTLFLKYHKTLYKGKALKFQMESQLKKREAALV 233 RGGFF RANE VEMMEKG+MF+DKYKYRTLFLKYHKTLYKGKA KFQ E+QL KREAAL Sbjct: 672 RGGFFKRANEVVEMMEKGNMFVDKYKYRTLFLKYHKTLYKGKAPKFQTEAQLSKREAALA 731 Query: 232 FKKWVGL 212 FKKWVGL Sbjct: 732 FKKWVGL 738 >ref|XP_019266394.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana attenuata] ref|XP_019266402.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana attenuata] ref|XP_019266411.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana attenuata] ref|XP_019266417.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana attenuata] ref|XP_019266420.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana attenuata] ref|XP_019266425.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana attenuata] ref|XP_019266431.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana attenuata] ref|XP_019266436.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana attenuata] ref|XP_019266445.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana attenuata] ref|XP_019266452.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana attenuata] ref|XP_019266458.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana attenuata] gb|OIT05530.1| pentatricopeptide repeat-containing protein, mitochondrial [Nicotiana attenuata] Length = 776 Score = 122 bits (307), Expect = 1e-29 Identities = 58/67 (86%), Positives = 62/67 (92%) Frame = -1 Query: 412 RGGFFVRANEAVEMMEKGSMFIDKYKYRTLFLKYHKTLYKGKALKFQMESQLKKREAALV 233 RGGFFVRANE VEMMEKG+MFIDKYKYRTLFLKYHKTLYKGKA KFQ E+Q+KKREAAL Sbjct: 709 RGGFFVRANEVVEMMEKGNMFIDKYKYRTLFLKYHKTLYKGKAPKFQSETQMKKREAALN 768 Query: 232 FKKWVGL 212 FK+W GL Sbjct: 769 FKRWAGL 775 >ref|XP_016451373.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Nicotiana tabacum] ref|XP_016451380.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Nicotiana tabacum] ref|XP_016451385.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Nicotiana tabacum] ref|XP_016451390.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Nicotiana tabacum] ref|XP_016451397.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Nicotiana tabacum] ref|XP_016451403.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Nicotiana tabacum] ref|XP_016451410.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Nicotiana tabacum] ref|XP_016451418.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Nicotiana tabacum] ref|XP_016451425.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Nicotiana tabacum] ref|XP_016451434.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Nicotiana tabacum] ref|XP_016451442.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Nicotiana tabacum] ref|XP_016451450.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Nicotiana tabacum] ref|XP_016451458.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Nicotiana tabacum] ref|XP_016451466.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Nicotiana tabacum] ref|XP_016451473.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Nicotiana tabacum] ref|XP_016451482.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Nicotiana tabacum] ref|XP_016451490.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Nicotiana tabacum] ref|XP_016451495.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Nicotiana tabacum] ref|XP_016451501.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Nicotiana tabacum] ref|XP_016451507.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Nicotiana tabacum] ref|XP_016451513.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Nicotiana tabacum] ref|XP_016451520.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Nicotiana tabacum] ref|XP_016451529.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Nicotiana tabacum] Length = 776 Score = 122 bits (307), Expect = 1e-29 Identities = 57/67 (85%), Positives = 63/67 (94%) Frame = -1 Query: 412 RGGFFVRANEAVEMMEKGSMFIDKYKYRTLFLKYHKTLYKGKALKFQMESQLKKREAALV 233 RGGFFVRANE VEMM+KG+MFIDKYKYRTLFLKYHKTLYKGKA KFQ+E+Q+KKREAAL Sbjct: 709 RGGFFVRANEVVEMMDKGNMFIDKYKYRTLFLKYHKTLYKGKAPKFQLETQMKKREAALN 768 Query: 232 FKKWVGL 212 FK+W GL Sbjct: 769 FKRWAGL 775