BLASTX nr result
ID: Rehmannia29_contig00035525
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00035525 (436 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP09717.1| unnamed protein product [Coffea canephora] 55 5e-06 >emb|CDP09717.1| unnamed protein product [Coffea canephora] Length = 613 Score = 55.5 bits (132), Expect = 5e-06 Identities = 22/69 (31%), Positives = 38/69 (55%) Frame = -1 Query: 427 DGPMFQVKNFANWWFSLCNMRNTACVQDRIQLSTHLLWWVWKTRNLWVFQKIKKSARETV 248 DG Q +N WW S+ N ++ ++L+ ++LW +WK RN W F ++ E++ Sbjct: 374 DGLTEQTRNILVWWNSMLEATNRIEGREHVELTVNILWQIWKRRNEWKFNAKRRHPWESI 433 Query: 247 RGAWEEWME 221 + A +EW E Sbjct: 434 KKALQEWQE 442