BLASTX nr result
ID: Rehmannia29_contig00035490
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00035490 (394 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZV29646.1| GATA transcription factor 22-like [Dorcoceras hyg... 68 1e-11 gb|KZV29647.1| GATA transcription factor 21-like [Dorcoceras hyg... 70 2e-11 ref|XP_012848547.1| PREDICTED: putative GATA transcription facto... 67 5e-11 gb|PIN08389.1| hypothetical protein CDL12_19041 [Handroanthus im... 68 6e-11 gb|PIN05739.1| hypothetical protein CDL12_21724 [Handroanthus im... 68 6e-11 ref|XP_022867805.1| GATA transcription factor 21-like [Olea euro... 67 1e-10 gb|EYU27295.1| hypothetical protein MIMGU_mgv1a020800mg [Erythra... 67 1e-10 ref|XP_011078200.2| LOW QUALITY PROTEIN: putative GATA transcrip... 66 4e-10 gb|PIN16831.1| hypothetical protein CDL12_10516 [Handroanthus im... 65 9e-10 ref|XP_015059328.1| PREDICTED: putative GATA transcription facto... 65 1e-09 ref|XP_009590203.1| PREDICTED: GATA transcription factor 21-like... 62 1e-09 ref|XP_012848016.1| PREDICTED: putative GATA transcription facto... 63 1e-09 ref|XP_016540407.1| PREDICTED: GATA transcription factor 21-like... 64 3e-09 ref|XP_004251667.1| PREDICTED: putative GATA transcription facto... 64 4e-09 gb|PHU08141.1| GATA transcription factor 16 [Capsicum chinense] 64 4e-09 gb|PHT73537.1| GATA transcription factor 16 [Capsicum annuum] 64 4e-09 gb|PHT52118.1| hypothetical protein CQW23_06580 [Capsicum baccatum] 64 4e-09 ref|XP_006353530.1| PREDICTED: putative GATA transcription facto... 63 5e-09 ref|XP_011093726.1| putative GATA transcription factor 22 [Sesam... 62 8e-09 ref|XP_016488017.1| PREDICTED: putative GATA transcription facto... 62 9e-09 >gb|KZV29646.1| GATA transcription factor 22-like [Dorcoceras hygrometricum] Length = 157 Score = 68.2 bits (165), Expect = 1e-11 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -1 Query: 184 KKIGLEDFLINLSNNLASQLRVFPEDVKDAAILLMALSSGLVH 56 +K+ LEDFLINLS NLA + RVFP+D KDAAILLMALSSGLVH Sbjct: 114 QKLDLEDFLINLSKNLAFRFRVFPQDEKDAAILLMALSSGLVH 156 >gb|KZV29647.1| GATA transcription factor 21-like [Dorcoceras hygrometricum] Length = 308 Score = 69.7 bits (169), Expect = 2e-11 Identities = 35/43 (81%), Positives = 38/43 (88%) Frame = -1 Query: 184 KKIGLEDFLINLSNNLASQLRVFPEDVKDAAILLMALSSGLVH 56 KK+ LEDFLINLS NLA + RVFP+D KDAAILLMALSSGLVH Sbjct: 265 KKLDLEDFLINLSKNLAFRFRVFPQDEKDAAILLMALSSGLVH 307 >ref|XP_012848547.1| PREDICTED: putative GATA transcription factor 22 [Erythranthe guttata] Length = 206 Score = 67.4 bits (163), Expect = 5e-11 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = -1 Query: 187 KKKIGLEDFLINLSNNLASQLRVFPEDVKDAAILLMALSSGLVH 56 KKK+G E+FLINLSNNL+ RVFP+D KDAAILLMALSSGLVH Sbjct: 163 KKKLGFEEFLINLSNNLSIH-RVFPDDEKDAAILLMALSSGLVH 205 >gb|PIN08389.1| hypothetical protein CDL12_19041 [Handroanthus impetiginosus] Length = 277 Score = 68.2 bits (165), Expect = 6e-11 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = -1 Query: 190 QKKKIGLEDFLINLSNNLASQLRVFPEDVKDAAILLMALSSGLVH 56 ++KK+G EDFLINLSNNL+ RVFP+D KDAAILLMALSSGLVH Sbjct: 233 EQKKLGFEDFLINLSNNLSFH-RVFPQDEKDAAILLMALSSGLVH 276 >gb|PIN05739.1| hypothetical protein CDL12_21724 [Handroanthus impetiginosus] Length = 277 Score = 68.2 bits (165), Expect = 6e-11 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = -1 Query: 190 QKKKIGLEDFLINLSNNLASQLRVFPEDVKDAAILLMALSSGLVH 56 ++KK+G EDFLINLSNNL+ RVFP+D KDAAILLMALSSGLVH Sbjct: 233 EQKKLGFEDFLINLSNNLSFH-RVFPQDEKDAAILLMALSSGLVH 276 >ref|XP_022867805.1| GATA transcription factor 21-like [Olea europaea var. sylvestris] Length = 303 Score = 67.4 bits (163), Expect = 1e-10 Identities = 36/43 (83%), Positives = 38/43 (88%) Frame = -1 Query: 184 KKIGLEDFLINLSNNLASQLRVFPEDVKDAAILLMALSSGLVH 56 KK+GLEDFLINLS NLA RVFP+D KDAAILLMALSSGLVH Sbjct: 261 KKLGLEDFLINLSKNLALN-RVFPQDEKDAAILLMALSSGLVH 302 >gb|EYU27295.1| hypothetical protein MIMGU_mgv1a020800mg [Erythranthe guttata] Length = 315 Score = 67.4 bits (163), Expect = 1e-10 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = -1 Query: 187 KKKIGLEDFLINLSNNLASQLRVFPEDVKDAAILLMALSSGLVH 56 KKK+G E+FLINLSNNL+ RVFP+D KDAAILLMALSSGLVH Sbjct: 272 KKKLGFEEFLINLSNNLSIH-RVFPDDEKDAAILLMALSSGLVH 314 >ref|XP_011078200.2| LOW QUALITY PROTEIN: putative GATA transcription factor 22 [Sesamum indicum] Length = 317 Score = 66.2 bits (160), Expect = 4e-10 Identities = 35/44 (79%), Positives = 38/44 (86%) Frame = -1 Query: 187 KKKIGLEDFLINLSNNLASQLRVFPEDVKDAAILLMALSSGLVH 56 +KK+G EDFLINLS NLA RVFPED KDAAILLMALSSGL+H Sbjct: 274 QKKLGFEDFLINLSKNLAFH-RVFPEDEKDAAILLMALSSGLLH 316 >gb|PIN16831.1| hypothetical protein CDL12_10516 [Handroanthus impetiginosus] Length = 306 Score = 65.1 bits (157), Expect = 9e-10 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -1 Query: 187 KKKIGLEDFLINLSNNLASQLRVFPEDVKDAAILLMALSSGLVH 56 +KKIG EDF INLS NL+ RVFPED KDAAILLMALSSGL+H Sbjct: 263 QKKIGFEDFFINLSKNLSFH-RVFPEDEKDAAILLMALSSGLIH 305 >ref|XP_015059328.1| PREDICTED: putative GATA transcription factor 22 [Solanum pennellii] Length = 327 Score = 65.1 bits (157), Expect = 1e-09 Identities = 35/45 (77%), Positives = 38/45 (84%) Frame = -1 Query: 190 QKKKIGLEDFLINLSNNLASQLRVFPEDVKDAAILLMALSSGLVH 56 QKKKI EDF +NLSNNLA RVFP+D K+AAILLMALSSGLVH Sbjct: 283 QKKKICFEDFFMNLSNNLAIH-RVFPQDEKEAAILLMALSSGLVH 326 >ref|XP_009590203.1| PREDICTED: GATA transcription factor 21-like, partial [Nicotiana tomentosiformis] ref|XP_016491814.1| PREDICTED: GATA transcription factor 21-like, partial [Nicotiana tabacum] Length = 135 Score = 62.4 bits (150), Expect = 1e-09 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = -1 Query: 187 KKKIGLEDFLINLSNNLASQLRVFPEDVKDAAILLMALSSGLVH 56 +KKI EDF +NLSNNLA RVFP+D K+AAILLMALSSGLVH Sbjct: 92 QKKICFEDFFVNLSNNLALH-RVFPQDEKEAAILLMALSSGLVH 134 >ref|XP_012848016.1| PREDICTED: putative GATA transcription factor 22 [Erythranthe guttata] gb|EYU28412.1| hypothetical protein MIMGU_mgv1a024876mg [Erythranthe guttata] Length = 165 Score = 62.8 bits (151), Expect = 1e-09 Identities = 36/47 (76%), Positives = 40/47 (85%), Gaps = 2/47 (4%) Frame = -1 Query: 190 QKKKIG--LEDFLINLSNNLASQLRVFPEDVKDAAILLMALSSGLVH 56 +KKKIG LE+FLINLS NL+ R+FPED KDAAILLMALSSGLVH Sbjct: 119 KKKKIGNKLEEFLINLSKNLSFH-RMFPEDEKDAAILLMALSSGLVH 164 >ref|XP_016540407.1| PREDICTED: GATA transcription factor 21-like [Capsicum annuum] Length = 323 Score = 63.5 bits (153), Expect = 3e-09 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = -1 Query: 190 QKKKIGLEDFLINLSNNLASQLRVFPEDVKDAAILLMALSSGLVH 56 QK+K+ EDF +NLSNNLA RVFP+D K+AAILLMALSSGLVH Sbjct: 279 QKQKLCFEDFFVNLSNNLAIH-RVFPQDEKEAAILLMALSSGLVH 322 >ref|XP_004251667.1| PREDICTED: putative GATA transcription factor 22 [Solanum lycopersicum] Length = 326 Score = 63.5 bits (153), Expect = 4e-09 Identities = 35/45 (77%), Positives = 37/45 (82%) Frame = -1 Query: 190 QKKKIGLEDFLINLSNNLASQLRVFPEDVKDAAILLMALSSGLVH 56 QKKKI EDF INLSNNLA RVFP+D K+AAILLMALSS LVH Sbjct: 282 QKKKICFEDFFINLSNNLAIH-RVFPQDEKEAAILLMALSSDLVH 325 >gb|PHU08141.1| GATA transcription factor 16 [Capsicum chinense] Length = 330 Score = 63.5 bits (153), Expect = 4e-09 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = -1 Query: 190 QKKKIGLEDFLINLSNNLASQLRVFPEDVKDAAILLMALSSGLVH 56 QK+K+ EDF +NLSNNLA RVFP+D K+AAILLMALSSGLVH Sbjct: 286 QKQKLCFEDFFVNLSNNLAIH-RVFPQDEKEAAILLMALSSGLVH 329 >gb|PHT73537.1| GATA transcription factor 16 [Capsicum annuum] Length = 333 Score = 63.5 bits (153), Expect = 4e-09 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = -1 Query: 190 QKKKIGLEDFLINLSNNLASQLRVFPEDVKDAAILLMALSSGLVH 56 QK+K+ EDF +NLSNNLA RVFP+D K+AAILLMALSSGLVH Sbjct: 289 QKQKLCFEDFFVNLSNNLAIH-RVFPQDEKEAAILLMALSSGLVH 332 >gb|PHT52118.1| hypothetical protein CQW23_06580 [Capsicum baccatum] Length = 540 Score = 63.5 bits (153), Expect = 4e-09 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = -1 Query: 190 QKKKIGLEDFLINLSNNLASQLRVFPEDVKDAAILLMALSSGLVH 56 QK+K+ EDF +NLSNNLA RVFP+D K+AAILLMALSSGLVH Sbjct: 275 QKQKLCFEDFFVNLSNNLAIH-RVFPQDEKEAAILLMALSSGLVH 318 >ref|XP_006353530.1| PREDICTED: putative GATA transcription factor 22 [Solanum tuberosum] Length = 323 Score = 63.2 bits (152), Expect = 5e-09 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = -1 Query: 190 QKKKIGLEDFLINLSNNLASQLRVFPEDVKDAAILLMALSSGLVH 56 QKK + EDF +NLSNNLA RVFP+D K+AAILLMALSSGLVH Sbjct: 279 QKKNLCFEDFFVNLSNNLAIH-RVFPQDEKEAAILLMALSSGLVH 322 >ref|XP_011093726.1| putative GATA transcription factor 22 [Sesamum indicum] Length = 308 Score = 62.4 bits (150), Expect = 8e-09 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = -1 Query: 172 LEDFLINLSNNLASQLRVFPEDVKDAAILLMALSSGLVH 56 LE+FLINLSNNLA RVFPED KDAAILLMALSSGLVH Sbjct: 270 LEEFLINLSNNLAVH-RVFPEDEKDAAILLMALSSGLVH 307 >ref|XP_016488017.1| PREDICTED: putative GATA transcription factor 22 [Nicotiana tabacum] Length = 313 Score = 62.4 bits (150), Expect = 9e-09 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = -1 Query: 187 KKKIGLEDFLINLSNNLASQLRVFPEDVKDAAILLMALSSGLVH 56 +KKI EDF +NLSNNLA RVFP+D K+AAILLMALSSGLVH Sbjct: 270 QKKICFEDFFVNLSNNLALH-RVFPQDEKEAAILLMALSSGLVH 312