BLASTX nr result
ID: Rehmannia29_contig00035229
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00035229 (442 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN02523.1| hypothetical protein CDL12_24961 [Handroanthus im... 39 3e-06 >gb|PIN02523.1| hypothetical protein CDL12_24961 [Handroanthus impetiginosus] Length = 380 Score = 39.3 bits (90), Expect(2) = 3e-06 Identities = 18/46 (39%), Positives = 25/46 (54%) Frame = -1 Query: 301 SILSEDSLESLRVNAGTPSTYHLRLPGPDDSPHVPPAGHATFFMDQ 164 S+ E LESLR P + + +P P+ S PP GH FF++Q Sbjct: 3 SLFGEGDLESLRTMYFVPPKFKVIIPSPNHSSDRPPKGHLYFFLEQ 48 Score = 39.3 bits (90), Expect(2) = 3e-06 Identities = 22/60 (36%), Positives = 33/60 (55%), Gaps = 3/60 (5%) Frame = -3 Query: 182 HLFYGPEAC---LRFPVPDFLCQISRSFGISLSQIVPNPIRLLVSFYIIVTHFKEEPNCQ 12 HL++ E LRF V +ISR FGI L Q PN I+++V + I+ + EP+ + Sbjct: 41 HLYFFLEQLKLGLRFSVLPLYAEISRVFGIPLFQFTPNSIKMMVGYAILCRNLGLEPSAR 100