BLASTX nr result
ID: Rehmannia29_contig00034872
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00034872 (659 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011086426.1| pentatricopeptide repeat-containing protein ... 63 8e-08 gb|EYU28680.1| hypothetical protein MIMGU_mgv1a019615mg [Erythra... 59 2e-06 ref|XP_012847508.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-06 gb|PIN15233.1| hypothetical protein CDL12_12134 [Handroanthus im... 58 3e-06 gb|PIN05640.1| hypothetical protein CDL12_21816 [Handroanthus im... 58 3e-06 >ref|XP_011086426.1| pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Sesamum indicum] ref|XP_011086427.1| pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Sesamum indicum] ref|XP_011086428.1| pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Sesamum indicum] ref|XP_011086429.1| pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Sesamum indicum] ref|XP_020551393.1| pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Sesamum indicum] ref|XP_020551394.1| pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Sesamum indicum] Length = 746 Score = 62.8 bits (151), Expect = 8e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -2 Query: 658 EMNYEEGNIDLTLMLCDEAVEKCLTNNSKGGR 563 EMNYEEGNIDL L+LCDEAVEKCL +NSKGGR Sbjct: 714 EMNYEEGNIDLALVLCDEAVEKCLIDNSKGGR 745 >gb|EYU28680.1| hypothetical protein MIMGU_mgv1a019615mg [Erythranthe guttata] Length = 697 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -2 Query: 658 EMNYEEGNIDLTLMLCDEAVEKCLTNNSKGGRS 560 EMNYEEGN+DLTL+LCDEAVEK + +NSKGGR+ Sbjct: 665 EMNYEEGNVDLTLVLCDEAVEKFVGDNSKGGRT 697 >ref|XP_012847508.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Erythranthe guttata] ref|XP_012847509.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Erythranthe guttata] Length = 738 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -2 Query: 658 EMNYEEGNIDLTLMLCDEAVEKCLTNNSKGGRS 560 EMNYEEGN+DLTL+LCDEAVEK + +NSKGGR+ Sbjct: 706 EMNYEEGNVDLTLVLCDEAVEKFVGDNSKGGRT 738 >gb|PIN15233.1| hypothetical protein CDL12_12134 [Handroanthus impetiginosus] Length = 711 Score = 58.2 bits (139), Expect = 3e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -2 Query: 658 EMNYEEGNIDLTLMLCDEAVEKCLTNNSKGGRS 560 EMNYE+GNIDL L+LCDEAVEKCL N+SK G++ Sbjct: 679 EMNYEDGNIDLALVLCDEAVEKCLINDSKDGKT 711 >gb|PIN05640.1| hypothetical protein CDL12_21816 [Handroanthus impetiginosus] Length = 745 Score = 58.2 bits (139), Expect = 3e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -2 Query: 658 EMNYEEGNIDLTLMLCDEAVEKCLTNNSKGGRS 560 EMNYE+GNIDL L+LCDEAVEKCL N+SK G++ Sbjct: 713 EMNYEDGNIDLALVLCDEAVEKCLINDSKDGKT 745