BLASTX nr result
ID: Rehmannia29_contig00034684
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00034684 (459 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN19734.1| hypothetical protein CDL12_07582 [Handroanthus im... 57 9e-07 >gb|PIN19734.1| hypothetical protein CDL12_07582 [Handroanthus impetiginosus] Length = 208 Score = 56.6 bits (135), Expect = 9e-07 Identities = 31/56 (55%), Positives = 36/56 (64%), Gaps = 4/56 (7%) Frame = -1 Query: 156 MVKNCLKSSLKVLNSTXXXXXXXXXXXGVLMIRVWQPDEE----ASSSDHFTIPWF 1 MVKN LKSSLKVLNS GVLMIR+WQPD + +SS +FT+PWF Sbjct: 1 MVKNLLKSSLKVLNSAIGMGGIAVIAYGVLMIRIWQPDVDDHSPSSSHHNFTLPWF 56