BLASTX nr result
ID: Rehmannia29_contig00034682
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00034682 (497 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022876895.1| G-type lectin S-receptor-like serine/threoni... 54 8e-06 >ref|XP_022876895.1| G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 [Olea europaea var. sylvestris] Length = 204 Score = 54.3 bits (129), Expect = 8e-06 Identities = 27/46 (58%), Positives = 33/46 (71%) Frame = -2 Query: 139 FXXXXLTALIIQKIYGATDTINVTQNITDGETIVSSGGTFELGFFR 2 F + L I KI A DTI+ TQ++ DG+T+VSSGGTFELGFFR Sbjct: 10 FLFLLTSILSILKISPAIDTISTTQSLKDGDTLVSSGGTFELGFFR 55