BLASTX nr result
ID: Rehmannia29_contig00034603
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00034603 (718 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020776153.1| uncharacterized histidine-rich protein DDB_G... 55 6e-06 >ref|XP_020776153.1| uncharacterized histidine-rich protein DDB_G0274557-like [Boleophthalmus pectinirostris] Length = 166 Score = 55.5 bits (132), Expect = 6e-06 Identities = 28/77 (36%), Positives = 34/77 (44%) Frame = -3 Query: 503 CTH*KLKSPLLHATHKPTHAHTEPDSYKYKPLTQYWLTDKHDPTFTHTHTVIK*HAHIQS 324 CTH + + TH P H HT +Y + Y T H+P HTHT H H + Sbjct: 31 CTHNHTHNCTYNHTHNPPHNHTHTCTYNHTHNCTYNHT--HNPPHNHTHTCTYNHTHNCT 88 Query: 323 TKHKHKPTFAHTHICIY 273 H H P HTH C Y Sbjct: 89 YNHTHNPPHNHTHTCTY 105