BLASTX nr result
ID: Rehmannia29_contig00034515
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00034515 (639 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020550647.1| E4 SUMO-protein ligase PIAL2-like [Sesamum i... 62 2e-07 ref|XP_020549907.1| LOW QUALITY PROTEIN: E4 SUMO-protein ligase ... 59 2e-06 >ref|XP_020550647.1| E4 SUMO-protein ligase PIAL2-like [Sesamum indicum] Length = 897 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -1 Query: 639 PSRAQELPSLAKQVCQCKIDTLIQAAIMVLMISVK 535 PSRA+ELPSL KQVCQCK DTL+ AAIMVLMISVK Sbjct: 88 PSRAEELPSLVKQVCQCKNDTLVLAAIMVLMISVK 122 >ref|XP_020549907.1| LOW QUALITY PROTEIN: E4 SUMO-protein ligase PIAL2-like [Sesamum indicum] Length = 585 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -1 Query: 639 PSRAQELPSLAKQVCQCKIDTLIQAAIMVLMISVK 535 PSRA+ELPSL KQVCQCK DTL+ AAI VLMIS+K Sbjct: 255 PSRAEELPSLVKQVCQCKNDTLLLAAITVLMISIK 289