BLASTX nr result
ID: Rehmannia29_contig00034390
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00034390 (416 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011087647.1| pentatricopeptide repeat-containing protein ... 128 1e-31 gb|EYU35016.1| hypothetical protein MIMGU_mgv1a023947mg, partial... 124 2e-30 ref|XP_012840236.1| PREDICTED: pentatricopeptide repeat-containi... 124 2e-30 gb|OMO57934.1| hypothetical protein COLO4_34979 [Corchorus olito... 116 1e-28 emb|CBI28142.3| unnamed protein product, partial [Vitis vinifera] 115 4e-27 gb|KZV54308.1| hypothetical protein F511_32086 [Dorcoceras hygro... 115 4e-27 ref|XP_002281719.2| PREDICTED: pentatricopeptide repeat-containi... 115 5e-27 ref|XP_023875336.1| pentatricopeptide repeat-containing protein ... 114 9e-27 ref|XP_023873156.1| pentatricopeptide repeat-containing protein ... 114 9e-27 ref|XP_022861682.1| pentatricopeptide repeat-containing protein ... 113 2e-26 ref|XP_018841068.1| PREDICTED: pentatricopeptide repeat-containi... 113 2e-26 gb|PPD69748.1| hypothetical protein GOBAR_DD33375 [Gossypium bar... 110 7e-26 gb|KDP32344.1| hypothetical protein JCGZ_13269 [Jatropha curcas] 110 1e-25 ref|XP_021624930.1| pentatricopeptide repeat-containing protein ... 110 2e-25 ref|XP_012078934.1| pentatricopeptide repeat-containing protein ... 110 2e-25 ref|XP_002529360.1| PREDICTED: pentatricopeptide repeat-containi... 110 2e-25 ref|XP_017610583.1| PREDICTED: pentatricopeptide repeat-containi... 110 3e-25 ref|XP_016690298.1| PREDICTED: pentatricopeptide repeat-containi... 110 3e-25 ref|XP_016690023.1| PREDICTED: pentatricopeptide repeat-containi... 110 3e-25 ref|XP_012447935.1| PREDICTED: pentatricopeptide repeat-containi... 110 3e-25 >ref|XP_011087647.1| pentatricopeptide repeat-containing protein At1g31430 [Sesamum indicum] ref|XP_011087648.1| pentatricopeptide repeat-containing protein At1g31430 [Sesamum indicum] Length = 617 Score = 128 bits (321), Expect = 1e-31 Identities = 63/79 (79%), Positives = 72/79 (91%), Gaps = 3/79 (3%) Frame = +2 Query: 2 KIIVPLYGALLSACRNYENVDMGERIAKRLVEIESSDSSSHTLLANIYAAACRWEDVTKV 181 KI++PLYGALLSACRN+ENVDMGERIAK+L++IESS+SSSHTLLA+IYAAA RWEDVTKV Sbjct: 533 KIVIPLYGALLSACRNFENVDMGERIAKQLLDIESSESSSHTLLASIYAAASRWEDVTKV 592 Query: 182 RKKMT---PKKLPGCSVLE 229 R+KMT KK PGCS LE Sbjct: 593 RRKMTTLGSKKFPGCSALE 611 >gb|EYU35016.1| hypothetical protein MIMGU_mgv1a023947mg, partial [Erythranthe guttata] Length = 567 Score = 124 bits (311), Expect = 2e-30 Identities = 64/82 (78%), Positives = 70/82 (85%), Gaps = 3/82 (3%) Frame = +2 Query: 2 KIIVPLYGALLSACRNYENVDMGERIAKRLVEIESSDSSSHTLLANIYAAACRWEDVTKV 181 +IIVPLYGALLSACRNYEN+ MGERIAKRL+EIE+SDSS TLLANIYAAA RWEDV KV Sbjct: 484 EIIVPLYGALLSACRNYENIGMGERIAKRLLEIEASDSSGRTLLANIYAAANRWEDVRKV 543 Query: 182 RKKMT---PKKLPGCSVLETHN 238 R+KMT KK PGCS+LE N Sbjct: 544 RRKMTMFGTKKSPGCSLLEIDN 565 >ref|XP_012840236.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Erythranthe guttata] Length = 622 Score = 124 bits (311), Expect = 2e-30 Identities = 64/82 (78%), Positives = 70/82 (85%), Gaps = 3/82 (3%) Frame = +2 Query: 2 KIIVPLYGALLSACRNYENVDMGERIAKRLVEIESSDSSSHTLLANIYAAACRWEDVTKV 181 +IIVPLYGALLSACRNYEN+ MGERIAKRL+EIE+SDSS TLLANIYAAA RWEDV KV Sbjct: 539 EIIVPLYGALLSACRNYENIGMGERIAKRLLEIEASDSSGRTLLANIYAAANRWEDVRKV 598 Query: 182 RKKMT---PKKLPGCSVLETHN 238 R+KMT KK PGCS+LE N Sbjct: 599 RRKMTMFGTKKSPGCSLLEIDN 620 >gb|OMO57934.1| hypothetical protein COLO4_34979 [Corchorus olitorius] Length = 334 Score = 116 bits (290), Expect = 1e-28 Identities = 58/82 (70%), Positives = 71/82 (86%), Gaps = 3/82 (3%) Frame = +2 Query: 2 KIIVPLYGALLSACRNYENVDMGERIAKRLVEIESSDSSSHTLLANIYAAACRWEDVTKV 181 ++IVPLYG+LLSACR Y NV+MGER+A+RLVEIESSDSS HTLLA+IYA+A RWEDVTKV Sbjct: 246 ELIVPLYGSLLSACRTYGNVEMGERVAQRLVEIESSDSSVHTLLAHIYASADRWEDVTKV 305 Query: 182 RKKMTP---KKLPGCSVLETHN 238 R+KM KK+PGCS +E ++ Sbjct: 306 REKMKDLGVKKVPGCSSVEVNS 327 >emb|CBI28142.3| unnamed protein product, partial [Vitis vinifera] Length = 571 Score = 115 bits (287), Expect = 4e-27 Identities = 58/81 (71%), Positives = 68/81 (83%), Gaps = 3/81 (3%) Frame = +2 Query: 2 KIIVPLYGALLSACRNYENVDMGERIAKRLVEIESSDSSSHTLLANIYAAACRWEDVTKV 181 ++IVPLYGALLSACR + NV+MGER+AKRLV IES DSS HTLLANIYA+A RWEDVTKV Sbjct: 443 EVIVPLYGALLSACRTHGNVEMGERVAKRLVGIESGDSSVHTLLANIYASADRWEDVTKV 502 Query: 182 RKKMTP---KKLPGCSVLETH 235 R+KM KK+PGCS +E + Sbjct: 503 RRKMKDLGVKKVPGCSSVEVN 523 >gb|KZV54308.1| hypothetical protein F511_32086 [Dorcoceras hygrometricum] Length = 1128 Score = 115 bits (288), Expect = 4e-27 Identities = 55/76 (72%), Positives = 66/76 (86%), Gaps = 3/76 (3%) Frame = +2 Query: 2 KIIVPLYGALLSACRNYENVDMGERIAKRLVEIESSDSSSHTLLANIYAAACRWEDVTKV 181 K+I PLYGALLSACRNYENVD+GERIA R++EI S DSS+H LLA+IYA+ACRW+D TKV Sbjct: 577 KLIYPLYGALLSACRNYENVDIGERIANRILEIGSCDSSNHMLLAHIYASACRWDDATKV 636 Query: 182 RKKMTP---KKLPGCS 220 R+KMT KK+PGC+ Sbjct: 637 RRKMTTTGHKKVPGCN 652 >ref|XP_002281719.2| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Vitis vinifera] Length = 662 Score = 115 bits (287), Expect = 5e-27 Identities = 58/81 (71%), Positives = 68/81 (83%), Gaps = 3/81 (3%) Frame = +2 Query: 2 KIIVPLYGALLSACRNYENVDMGERIAKRLVEIESSDSSSHTLLANIYAAACRWEDVTKV 181 ++IVPLYGALLSACR + NV+MGER+AKRLV IES DSS HTLLANIYA+A RWEDVTKV Sbjct: 534 EVIVPLYGALLSACRTHGNVEMGERVAKRLVGIESGDSSVHTLLANIYASADRWEDVTKV 593 Query: 182 RKKMTP---KKLPGCSVLETH 235 R+KM KK+PGCS +E + Sbjct: 594 RRKMKDLGVKKVPGCSSVEVN 614 >ref|XP_023875336.1| pentatricopeptide repeat-containing protein At1g31430-like [Quercus suber] Length = 666 Score = 114 bits (285), Expect = 9e-27 Identities = 57/81 (70%), Positives = 70/81 (86%), Gaps = 3/81 (3%) Frame = +2 Query: 2 KIIVPLYGALLSACRNYENVDMGERIAKRLVEIESSDSSSHTLLANIYAAACRWEDVTKV 181 +I+VPLYG+LLSACR + NV+MGER+A+RLV+IESSDSS HTLLANIYA+A RWEDVTKV Sbjct: 538 EIVVPLYGSLLSACRIHGNVEMGERVAERLVKIESSDSSIHTLLANIYASADRWEDVTKV 597 Query: 182 RKKMTP---KKLPGCSVLETH 235 R+KM KK+PGCS +E + Sbjct: 598 RRKMKDLGVKKVPGCSSIEVN 618 >ref|XP_023873156.1| pentatricopeptide repeat-containing protein At1g31430-like [Quercus suber] Length = 666 Score = 114 bits (285), Expect = 9e-27 Identities = 57/81 (70%), Positives = 70/81 (86%), Gaps = 3/81 (3%) Frame = +2 Query: 2 KIIVPLYGALLSACRNYENVDMGERIAKRLVEIESSDSSSHTLLANIYAAACRWEDVTKV 181 +I+VPLYG+LLSACR + NV+MGER+A+RLV+IESSDSS HTLLANIYA+A RWEDVTKV Sbjct: 538 EIVVPLYGSLLSACRIHGNVEMGERVAERLVKIESSDSSIHTLLANIYASADRWEDVTKV 597 Query: 182 RKKMTP---KKLPGCSVLETH 235 R+KM KK+PGCS +E + Sbjct: 598 RRKMKDLGVKKVPGCSSIEVN 618 >ref|XP_022861682.1| pentatricopeptide repeat-containing protein At1g31430 [Olea europaea var. sylvestris] Length = 632 Score = 113 bits (283), Expect = 2e-26 Identities = 57/78 (73%), Positives = 68/78 (87%), Gaps = 3/78 (3%) Frame = +2 Query: 5 IIVPLYGALLSACRNYENVDMGERIAKRLVEIESSDSSSHTLLANIYAAACRWEDVTKVR 184 IIVPLYG+LLSACRNY NVDMG+RIA+ L++IESSDSS+HTLLANIYA+A RW DVT+VR Sbjct: 544 IIVPLYGSLLSACRNYGNVDMGQRIAQWLMKIESSDSSTHTLLANIYASANRWNDVTQVR 603 Query: 185 KKMT---PKKLPGCSVLE 229 +KM KK PGCS++E Sbjct: 604 RKMRTLGAKKSPGCSLIE 621 >ref|XP_018841068.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Juglans regia] Length = 665 Score = 113 bits (282), Expect = 2e-26 Identities = 55/79 (69%), Positives = 69/79 (87%), Gaps = 3/79 (3%) Frame = +2 Query: 2 KIIVPLYGALLSACRNYENVDMGERIAKRLVEIESSDSSSHTLLANIYAAACRWEDVTKV 181 +I++PLYG+LLSACR Y NV+M ER+A+RLV+IESSDSS HTLLANIYA+A RW+DVTKV Sbjct: 537 EIVIPLYGSLLSACRVYGNVEMAERVAERLVKIESSDSSIHTLLANIYASADRWQDVTKV 596 Query: 182 RKKMTP---KKLPGCSVLE 229 R+KM KK+PGCS++E Sbjct: 597 RRKMKDLGVKKVPGCSLIE 615 >gb|PPD69748.1| hypothetical protein GOBAR_DD33375 [Gossypium barbadense] Length = 397 Score = 110 bits (274), Expect = 7e-26 Identities = 55/79 (69%), Positives = 67/79 (84%), Gaps = 3/79 (3%) Frame = +2 Query: 8 IVPLYGALLSACRNYENVDMGERIAKRLVEIESSDSSSHTLLANIYAAACRWEDVTKVRK 187 IVPLYG+LLSACR Y NV+MGER+A+RLVEI+SSDSS HTLL+NIYA+A RWEDV KVR+ Sbjct: 313 IVPLYGSLLSACRTYGNVEMGERMAQRLVEIQSSDSSVHTLLSNIYASADRWEDVKKVRE 372 Query: 188 KMTP---KKLPGCSVLETH 235 KM KK+PGCS ++ + Sbjct: 373 KMKDLGVKKVPGCSSIKVN 391 >gb|KDP32344.1| hypothetical protein JCGZ_13269 [Jatropha curcas] Length = 610 Score = 110 bits (276), Expect = 1e-25 Identities = 56/78 (71%), Positives = 66/78 (84%), Gaps = 3/78 (3%) Frame = +2 Query: 5 IIVPLYGALLSACRNYENVDMGERIAKRLVEIESSDSSSHTLLANIYAAACRWEDVTKVR 184 I+VPLY +LLSACR Y NV+MGER+AK+LV+IESSDS HTLLANIYA+A RWEDVTKVR Sbjct: 465 IVVPLYVSLLSACRIYRNVEMGERVAKQLVKIESSDSGVHTLLANIYASADRWEDVTKVR 524 Query: 185 KKMTP---KKLPGCSVLE 229 +KM +KLPGCS +E Sbjct: 525 RKMKDLGVQKLPGCSSIE 542 >ref|XP_021624930.1| pentatricopeptide repeat-containing protein At1g31430 [Manihot esculenta] gb|OAY39308.1| hypothetical protein MANES_10G084100 [Manihot esculenta] Length = 659 Score = 110 bits (276), Expect = 2e-25 Identities = 56/78 (71%), Positives = 67/78 (85%), Gaps = 3/78 (3%) Frame = +2 Query: 5 IIVPLYGALLSACRNYENVDMGERIAKRLVEIESSDSSSHTLLANIYAAACRWEDVTKVR 184 I+VPLYG+LLSACR Y+NVDMG+R+A +LV+I SSDSS HTLLANIYA+A +WEDVTKVR Sbjct: 537 ILVPLYGSLLSACRLYKNVDMGKRVAMQLVKIGSSDSSVHTLLANIYASAEKWEDVTKVR 596 Query: 185 KKMTP---KKLPGCSVLE 229 +KM KKLPGCS +E Sbjct: 597 RKMKDLGVKKLPGCSSIE 614 >ref|XP_012078934.1| pentatricopeptide repeat-containing protein At1g31430 [Jatropha curcas] Length = 682 Score = 110 bits (276), Expect = 2e-25 Identities = 56/78 (71%), Positives = 66/78 (84%), Gaps = 3/78 (3%) Frame = +2 Query: 5 IIVPLYGALLSACRNYENVDMGERIAKRLVEIESSDSSSHTLLANIYAAACRWEDVTKVR 184 I+VPLY +LLSACR Y NV+MGER+AK+LV+IESSDS HTLLANIYA+A RWEDVTKVR Sbjct: 537 IVVPLYVSLLSACRIYRNVEMGERVAKQLVKIESSDSGVHTLLANIYASADRWEDVTKVR 596 Query: 185 KKMTP---KKLPGCSVLE 229 +KM +KLPGCS +E Sbjct: 597 RKMKDLGVQKLPGCSSIE 614 >ref|XP_002529360.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Ricinus communis] gb|EEF33027.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 683 Score = 110 bits (275), Expect = 2e-25 Identities = 57/78 (73%), Positives = 64/78 (82%), Gaps = 3/78 (3%) Frame = +2 Query: 5 IIVPLYGALLSACRNYENVDMGERIAKRLVEIESSDSSSHTLLANIYAAACRWEDVTKVR 184 I VPLYG+LLSACR Y NV+MGER+AK+LV+ ESSDSS HTLLANIYA A RWEDVTKVR Sbjct: 540 ITVPLYGSLLSACRIYGNVEMGERVAKQLVKFESSDSSVHTLLANIYAFADRWEDVTKVR 599 Query: 185 KKMTP---KKLPGCSVLE 229 +KM KK PGCS +E Sbjct: 600 RKMKDLGVKKTPGCSSIE 617 >ref|XP_017610583.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430-like [Gossypium arboreum] ref|XP_017637001.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Gossypium arboreum] Length = 621 Score = 110 bits (274), Expect = 3e-25 Identities = 55/79 (69%), Positives = 67/79 (84%), Gaps = 3/79 (3%) Frame = +2 Query: 8 IVPLYGALLSACRNYENVDMGERIAKRLVEIESSDSSSHTLLANIYAAACRWEDVTKVRK 187 IVPLYG+LLSACR Y NV+MGER+A+RLVEI+SSDSS HTLL+NIYA+A RWEDV KVR+ Sbjct: 537 IVPLYGSLLSACRTYGNVEMGERMAQRLVEIQSSDSSVHTLLSNIYASADRWEDVKKVRE 596 Query: 188 KMTP---KKLPGCSVLETH 235 KM KK+PGCS ++ + Sbjct: 597 KMKDLGVKKVPGCSSIKVN 615 >ref|XP_016690298.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430-like [Gossypium hirsutum] Length = 621 Score = 110 bits (274), Expect = 3e-25 Identities = 55/79 (69%), Positives = 67/79 (84%), Gaps = 3/79 (3%) Frame = +2 Query: 8 IVPLYGALLSACRNYENVDMGERIAKRLVEIESSDSSSHTLLANIYAAACRWEDVTKVRK 187 IVPLYG+LLSACR Y NV+MGER+A+RLVEI+SSDSS HTLL+NIYA+A RWEDV KVR+ Sbjct: 537 IVPLYGSLLSACRTYGNVEMGERMAQRLVEIQSSDSSVHTLLSNIYASADRWEDVKKVRE 596 Query: 188 KMTP---KKLPGCSVLETH 235 KM KK+PGCS ++ + Sbjct: 597 KMKDLGVKKVPGCSSIKVN 615 >ref|XP_016690023.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430-like [Gossypium hirsutum] Length = 621 Score = 110 bits (274), Expect = 3e-25 Identities = 55/79 (69%), Positives = 67/79 (84%), Gaps = 3/79 (3%) Frame = +2 Query: 8 IVPLYGALLSACRNYENVDMGERIAKRLVEIESSDSSSHTLLANIYAAACRWEDVTKVRK 187 IVPLYG+LLSACR Y NV+MGER+A+RLVEI+SSDSS HTLL+NIYA+A RWEDV KVR+ Sbjct: 537 IVPLYGSLLSACRTYGNVEMGERMAQRLVEIQSSDSSVHTLLSNIYASADRWEDVKKVRE 596 Query: 188 KMTP---KKLPGCSVLETH 235 KM KK+PGCS ++ + Sbjct: 597 KMKDLGVKKVPGCSSIKVN 615 >ref|XP_012447935.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Gossypium raimondii] gb|KJB54118.1| hypothetical protein B456_009G021500 [Gossypium raimondii] Length = 621 Score = 110 bits (274), Expect = 3e-25 Identities = 55/79 (69%), Positives = 67/79 (84%), Gaps = 3/79 (3%) Frame = +2 Query: 8 IVPLYGALLSACRNYENVDMGERIAKRLVEIESSDSSSHTLLANIYAAACRWEDVTKVRK 187 IVPLYG+LLSACR Y NV+MGER+A+RLVEI+SSDSS HTLL+NIYA+A RWEDV KVR+ Sbjct: 537 IVPLYGSLLSACRTYGNVEMGERMAQRLVEIQSSDSSVHTLLSNIYASADRWEDVKKVRE 596 Query: 188 KMTP---KKLPGCSVLETH 235 KM KK+PGCS ++ + Sbjct: 597 KMKDLGVKKVPGCSSIKVN 615