BLASTX nr result
ID: Rehmannia29_contig00034178
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00034178 (1173 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011084141.1| protein transport protein SEC23-like [Sesamu... 63 7e-07 gb|EPS58382.1| hypothetical protein M569_16432, partial [Genlise... 60 3e-06 >ref|XP_011084141.1| protein transport protein SEC23-like [Sesamum indicum] Length = 782 Score = 62.8 bits (151), Expect = 7e-07 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -1 Query: 1173 STLGNEDLIQGFDQEAAAVVMARLASYKMEME 1078 STLGNEDLIQGFDQE AAVVMARLASYKMEME Sbjct: 524 STLGNEDLIQGFDQEVAAVVMARLASYKMEME 555 >gb|EPS58382.1| hypothetical protein M569_16432, partial [Genlisea aurea] Length = 322 Score = 59.7 bits (143), Expect = 3e-06 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 1173 STLGNEDLIQGFDQEAAAVVMARLASYKMEME 1078 STLGNEDL+QGFDQE AAVV+ARL SYKMEME Sbjct: 143 STLGNEDLVQGFDQEVAAVVLARLVSYKMEME 174