BLASTX nr result
ID: Rehmannia29_contig00033882
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00033882 (560 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN17889.1| Placental protein 11 [Handroanthus impetiginosus] 60 3e-07 gb|PIN17890.1| Placental protein 11 [Handroanthus impetiginosus] 56 8e-06 >gb|PIN17889.1| Placental protein 11 [Handroanthus impetiginosus] Length = 417 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = -3 Query: 558 GEPEDHDGSSSNTDHNTTAWNRRQEQSYGRNDERKSGELSHAVRT 424 GEPEDHDGSSSN D+ T RQE+ YGRN+E +SGE A+RT Sbjct: 45 GEPEDHDGSSSNADYRTRPSYTRQEERYGRNEEWESGESRPAIRT 89 >gb|PIN17890.1| Placental protein 11 [Handroanthus impetiginosus] Length = 442 Score = 55.8 bits (133), Expect = 8e-06 Identities = 25/45 (55%), Positives = 31/45 (68%) Frame = -3 Query: 558 GEPEDHDGSSSNTDHNTTAWNRRQEQSYGRNDERKSGELSHAVRT 424 GE +DHDGSSS DH T R+E+ YGRN+ER+SGE +RT Sbjct: 34 GETKDHDGSSSKADHRTRPSQTRREERYGRNEERESGESQPVMRT 78