BLASTX nr result
ID: Rehmannia29_contig00033843
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00033843 (1209 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011072964.2| psbP-like protein 1, chloroplastic [Sesamum ... 66 3e-08 >ref|XP_011072964.2| psbP-like protein 1, chloroplastic [Sesamum indicum] Length = 355 Score = 66.2 bits (160), Expect = 3e-08 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -1 Query: 111 TSMTDRPGRRQLLAMGTTIAPWLFFCQQAPTTFAAE 4 +S DRPGRRQLLAMGTT+APWLFF QQ PTTFAAE Sbjct: 165 SSCEDRPGRRQLLAMGTTLAPWLFFSQQTPTTFAAE 200