BLASTX nr result
ID: Rehmannia29_contig00033682
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00033682 (783 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN07634.1| hypothetical protein CDL12_19802 [Handroanthus im... 66 2e-09 ref|XP_012836837.1| PREDICTED: uncharacterized protein LOC105957... 64 1e-08 ref|XP_011088039.1| uncharacterized protein LOC105169350 [Sesamu... 60 3e-07 >gb|PIN07634.1| hypothetical protein CDL12_19802 [Handroanthus impetiginosus] Length = 218 Score = 66.2 bits (160), Expect = 2e-09 Identities = 32/45 (71%), Positives = 39/45 (86%), Gaps = 2/45 (4%) Frame = +2 Query: 2 GWSYSRRNGVTSGAETNLSGQREKSMALNSEGLE--VGRFQFLIS 130 GW+YSRRNG+T GAE+NLS QREKSMALNSEGLE + R +FL++ Sbjct: 109 GWNYSRRNGITMGAESNLSNQREKSMALNSEGLEGLIPRAKFLLT 153 >ref|XP_012836837.1| PREDICTED: uncharacterized protein LOC105957463 [Erythranthe guttata] gb|EYU37543.1| hypothetical protein MIMGU_mgv1a013536mg [Erythranthe guttata] Length = 217 Score = 64.3 bits (155), Expect = 1e-08 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +2 Query: 2 GWSYSRRNGVTSGAETNLSGQREKSMALNSEGLE 103 GWSYSRRNGVT+GAE +LS QREKSMALNSEGLE Sbjct: 108 GWSYSRRNGVTTGAEADLSNQREKSMALNSEGLE 141 >ref|XP_011088039.1| uncharacterized protein LOC105169350 [Sesamum indicum] Length = 217 Score = 60.5 bits (145), Expect = 3e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +2 Query: 2 GWSYSRRNGVTSGAETNLSGQREKSMALNSEGLE 103 GW+YSRRNGVT+ AE +LS QREKSMALNSEGLE Sbjct: 108 GWNYSRRNGVTTDAEADLSNQREKSMALNSEGLE 141