BLASTX nr result
ID: Rehmannia29_contig00033481
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00033481 (489 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACN37093.1| unknown [Zea mays] 51 9e-06 >gb|ACN37093.1| unknown [Zea mays] Length = 53 Score = 50.8 bits (120), Expect = 9e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = +1 Query: 400 ACFEHSNFFKVTALKARPGELRPTVSRGQK 489 ACFEHSNFFKVTA +ARPG+LRP R QK Sbjct: 13 ACFEHSNFFKVTAPEARPGQLRPGAHRRQK 42