BLASTX nr result
ID: Rehmannia29_contig00033317
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00033317 (562 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022865320.1| ATP synthase subunit d, mitochondrial [Olea ... 70 1e-11 ref|XP_022847416.1| ATP synthase subunit d, mitochondrial-like [... 69 3e-11 ref|XP_022883118.1| ATP synthase subunit d, mitochondrial-like [... 69 3e-11 gb|PIM98084.1| Mitochondrial F1F0-ATP synthase, subunit d/ATP7 [... 69 3e-11 ref|XP_011099845.1| ATP synthase subunit d, mitochondrial [Sesam... 69 3e-11 ref|XP_012838646.1| PREDICTED: ATP synthase subunit d, mitochond... 69 3e-11 gb|PIN03257.1| Mitochondrial F1F0-ATP synthase, subunit d/ATP7 [... 69 4e-11 gb|KZV47199.1| ATP synthase D chain, mitochondrial [Dorcoceras h... 69 4e-11 ref|XP_022890778.1| ATP synthase subunit d, mitochondrial-like [... 68 5e-11 ref|XP_011089871.1| ATP synthase subunit d, mitochondrial [Sesam... 67 1e-10 ref|XP_012827753.1| PREDICTED: ATP synthase subunit d, mitochond... 66 3e-10 ref|XP_010412889.1| PREDICTED: ATP synthase subunit d, mitochond... 64 7e-10 ref|XP_021666671.1| ATP synthase subunit d, mitochondrial-like [... 62 4e-09 ref|XP_018463563.1| PREDICTED: ATP synthase subunit d, mitochond... 63 6e-09 ref|XP_013595345.1| PREDICTED: ATP synthase subunit d, mitochond... 63 6e-09 ref|XP_010509553.1| PREDICTED: ATP synthase subunit d, mitochond... 63 6e-09 ref|XP_010516312.1| PREDICTED: ATP synthase subunit d, mitochond... 63 6e-09 ref|XP_009139469.1| PREDICTED: ATP synthase subunit d, mitochond... 63 6e-09 ref|XP_013705597.1| ATP synthase subunit d, mitochondrial [Brass... 63 6e-09 ref|XP_009136673.1| PREDICTED: ATP synthase subunit d, mitochond... 63 6e-09 >ref|XP_022865320.1| ATP synthase subunit d, mitochondrial [Olea europaea var. sylvestris] Length = 168 Score = 70.1 bits (170), Expect = 1e-11 Identities = 35/42 (83%), Positives = 37/42 (88%), Gaps = 1/42 (2%) Frame = -2 Query: 123 NHLIVFYI-FYDEVKIPQYVDNVTPQYKPKFDALLVELKEAE 1 +HL+ Y YDEVKIPQYVDNVTPQYKPKFDALLVELKEAE Sbjct: 73 SHLVDMYKQAYDEVKIPQYVDNVTPQYKPKFDALLVELKEAE 114 >ref|XP_022847416.1| ATP synthase subunit d, mitochondrial-like [Olea europaea var. sylvestris] Length = 168 Score = 68.9 bits (167), Expect = 3e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 96 YDEVKIPQYVDNVTPQYKPKFDALLVELKEAE 1 YDEVKIPQYVDNVTPQYKPKFDALLVELKEAE Sbjct: 83 YDEVKIPQYVDNVTPQYKPKFDALLVELKEAE 114 >ref|XP_022883118.1| ATP synthase subunit d, mitochondrial-like [Olea europaea var. sylvestris] Length = 168 Score = 68.9 bits (167), Expect = 3e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 96 YDEVKIPQYVDNVTPQYKPKFDALLVELKEAE 1 YDEVKIPQYVDNVTPQYKPKFDALLVELKEAE Sbjct: 83 YDEVKIPQYVDNVTPQYKPKFDALLVELKEAE 114 >gb|PIM98084.1| Mitochondrial F1F0-ATP synthase, subunit d/ATP7 [Handroanthus impetiginosus] Length = 168 Score = 68.9 bits (167), Expect = 3e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 96 YDEVKIPQYVDNVTPQYKPKFDALLVELKEAE 1 YDEVKIPQYVDNVTPQYKPKFDALLVELKEAE Sbjct: 83 YDEVKIPQYVDNVTPQYKPKFDALLVELKEAE 114 >ref|XP_011099845.1| ATP synthase subunit d, mitochondrial [Sesamum indicum] Length = 168 Score = 68.9 bits (167), Expect = 3e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 96 YDEVKIPQYVDNVTPQYKPKFDALLVELKEAE 1 YDEVKIPQYVDNVTPQYKPKFDALLVELKEAE Sbjct: 83 YDEVKIPQYVDNVTPQYKPKFDALLVELKEAE 114 >ref|XP_012838646.1| PREDICTED: ATP synthase subunit d, mitochondrial [Erythranthe guttata] gb|EYU36206.1| hypothetical protein MIMGU_mgv1a015100mg [Erythranthe guttata] Length = 168 Score = 68.9 bits (167), Expect = 3e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 96 YDEVKIPQYVDNVTPQYKPKFDALLVELKEAE 1 YDEVKIPQYVDNVTPQYKPKFDALLVELKEAE Sbjct: 83 YDEVKIPQYVDNVTPQYKPKFDALLVELKEAE 114 >gb|PIN03257.1| Mitochondrial F1F0-ATP synthase, subunit d/ATP7 [Handroanthus impetiginosus] Length = 168 Score = 68.6 bits (166), Expect = 4e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -2 Query: 96 YDEVKIPQYVDNVTPQYKPKFDALLVELKEAE 1 YDE+KIPQYVDNVTPQYKPKFDALLVELKEAE Sbjct: 83 YDEIKIPQYVDNVTPQYKPKFDALLVELKEAE 114 >gb|KZV47199.1| ATP synthase D chain, mitochondrial [Dorcoceras hygrometricum] Length = 168 Score = 68.6 bits (166), Expect = 4e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -2 Query: 96 YDEVKIPQYVDNVTPQYKPKFDALLVELKEAE 1 YDE+KIPQYVDNVTPQYKPKFDALLVELKEAE Sbjct: 83 YDEIKIPQYVDNVTPQYKPKFDALLVELKEAE 114 >ref|XP_022890778.1| ATP synthase subunit d, mitochondrial-like [Olea europaea var. sylvestris] Length = 168 Score = 68.2 bits (165), Expect = 5e-11 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -2 Query: 96 YDEVKIPQYVDNVTPQYKPKFDALLVELKEAE 1 YDEVKIPQY+DNVTPQYKPKFDALL+ELKEAE Sbjct: 83 YDEVKIPQYIDNVTPQYKPKFDALLIELKEAE 114 >ref|XP_011089871.1| ATP synthase subunit d, mitochondrial [Sesamum indicum] Length = 168 Score = 67.4 bits (163), Expect = 1e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -2 Query: 96 YDEVKIPQYVDNVTPQYKPKFDALLVELKEAE 1 YDEVKIP+YVDNVTPQYKPKFDALLVELKEAE Sbjct: 83 YDEVKIPKYVDNVTPQYKPKFDALLVELKEAE 114 >ref|XP_012827753.1| PREDICTED: ATP synthase subunit d, mitochondrial-like [Erythranthe guttata] gb|EYU18878.1| hypothetical protein MIMGU_mgv1a015093mg [Erythranthe guttata] Length = 168 Score = 66.2 bits (160), Expect = 3e-10 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -2 Query: 96 YDEVKIPQYVDNVTPQYKPKFDALLVELKEAE 1 YDEVKIP+YVDNVTPQYKPKFD+LLVELKEAE Sbjct: 83 YDEVKIPKYVDNVTPQYKPKFDSLLVELKEAE 114 >ref|XP_010412889.1| PREDICTED: ATP synthase subunit d, mitochondrial-like [Camelina sativa] Length = 102 Score = 63.5 bits (153), Expect = 7e-10 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -2 Query: 102 IFYDEVKIPQYVDNVTPQYKPKFDALLVELKEAE 1 I YD V+IP+YVDNVTP+YKPKFDALLVELKEAE Sbjct: 15 IAYDSVEIPKYVDNVTPEYKPKFDALLVELKEAE 48 >ref|XP_021666671.1| ATP synthase subunit d, mitochondrial-like [Hevea brasiliensis] Length = 121 Score = 62.0 bits (149), Expect = 4e-09 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = -2 Query: 159 IITIFSSSDLKFNHL-IVFYIFYDEVKIPQYVDNVTPQYKPKFDALLVELKEAE 1 I IFS S+ + L ++FY +++P+YVD VTPQYKPKFDALLVELKEAE Sbjct: 14 ISAIFSLSEFQNASLSLLFYFSLAGIEVPKYVDTVTPQYKPKFDALLVELKEAE 67 >ref|XP_018463563.1| PREDICTED: ATP synthase subunit d, mitochondrial-like [Raphanus sativus] Length = 168 Score = 62.8 bits (151), Expect = 6e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 96 YDEVKIPQYVDNVTPQYKPKFDALLVELKEAE 1 YD V+IP+YVDNVTP+YKPKFDALLVELKEAE Sbjct: 83 YDSVEIPKYVDNVTPEYKPKFDALLVELKEAE 114 >ref|XP_013595345.1| PREDICTED: ATP synthase subunit d, mitochondrial [Brassica oleracea var. oleracea] Length = 168 Score = 62.8 bits (151), Expect = 6e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 96 YDEVKIPQYVDNVTPQYKPKFDALLVELKEAE 1 YD V+IP+YVDNVTP+YKPKFDALLVELKEAE Sbjct: 83 YDSVEIPKYVDNVTPEYKPKFDALLVELKEAE 114 >ref|XP_010509553.1| PREDICTED: ATP synthase subunit d, mitochondrial [Camelina sativa] Length = 168 Score = 62.8 bits (151), Expect = 6e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 96 YDEVKIPQYVDNVTPQYKPKFDALLVELKEAE 1 YD V+IP+YVDNVTP+YKPKFDALLVELKEAE Sbjct: 83 YDSVEIPKYVDNVTPEYKPKFDALLVELKEAE 114 >ref|XP_010516312.1| PREDICTED: ATP synthase subunit d, mitochondrial [Camelina sativa] Length = 168 Score = 62.8 bits (151), Expect = 6e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 96 YDEVKIPQYVDNVTPQYKPKFDALLVELKEAE 1 YD V+IP+YVDNVTP+YKPKFDALLVELKEAE Sbjct: 83 YDSVEIPKYVDNVTPEYKPKFDALLVELKEAE 114 >ref|XP_009139469.1| PREDICTED: ATP synthase subunit d, mitochondrial-like [Brassica rapa] Length = 168 Score = 62.8 bits (151), Expect = 6e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 96 YDEVKIPQYVDNVTPQYKPKFDALLVELKEAE 1 YD V+IP+YVDNVTP+YKPKFDALLVELKEAE Sbjct: 83 YDSVEIPKYVDNVTPEYKPKFDALLVELKEAE 114 >ref|XP_013705597.1| ATP synthase subunit d, mitochondrial [Brassica napus] emb|CDY29076.1| BnaC07g32820D [Brassica napus] Length = 168 Score = 62.8 bits (151), Expect = 6e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 96 YDEVKIPQYVDNVTPQYKPKFDALLVELKEAE 1 YD V+IP+YVDNVTP+YKPKFDALLVELKEAE Sbjct: 83 YDSVEIPKYVDNVTPEYKPKFDALLVELKEAE 114 >ref|XP_009136673.1| PREDICTED: ATP synthase subunit d, mitochondrial [Brassica rapa] ref|XP_013737102.1| ATP synthase subunit d, mitochondrial [Brassica napus] ref|XP_013742737.1| ATP synthase subunit d, mitochondrial [Brassica napus] ref|XP_018478186.1| PREDICTED: ATP synthase subunit d, mitochondrial [Raphanus sativus] emb|CDY23204.1| BnaA04g05550D [Brassica napus] Length = 168 Score = 62.8 bits (151), Expect = 6e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 96 YDEVKIPQYVDNVTPQYKPKFDALLVELKEAE 1 YD V+IP+YVDNVTP+YKPKFDALLVELKEAE Sbjct: 83 YDSVEIPKYVDNVTPEYKPKFDALLVELKEAE 114