BLASTX nr result
ID: Rehmannia29_contig00033234
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00033234 (745 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011074817.1| uncharacterized protein LOC105159446 [Sesamu... 59 2e-06 >ref|XP_011074817.1| uncharacterized protein LOC105159446 [Sesamum indicum] ref|XP_011074818.1| uncharacterized protein LOC105159446 [Sesamum indicum] Length = 562 Score = 59.3 bits (142), Expect = 2e-06 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = +3 Query: 615 RLQNLPQSHYLSAPVASHKHATAAANNQGDSEKRFSKHRSDTK 743 RL NLPQS Y+SA SH+ AAA NQGDSEK+F+K RSD K Sbjct: 415 RLYNLPQSQYVSASAESHQRPAAAARNQGDSEKKFTKQRSDMK 457